KEGG   Homo sapiens (human): 5795Help
Entry
5795              CDS       T01001                                 

Gene name
PTPRJ, CD148, DEP1, HPTPeta, R-PTP-ETA, SCC1
Definition
(RefSeq) protein tyrosine phosphatase receptor type J
  KO
K05698  receptor-type tyrosine-protein phosphatase eta [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    5795 (PTPRJ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5795 (PTPRJ)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    5795 (PTPRJ)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5795 (PTPRJ)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    5795 (PTPRJ)
CD molecules [BR:hsa04090]
 Proteins
  5795 (PTPRJ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTP_tm Y_phosphatase fn3 DSPc PTPlike_phytase Y_phosphatase3 Interfer-bind Syndecan
Motif
Other DBs
NCBI-GeneID: 5795
NCBI-ProteinID: NP_002834
OMIM: 600925
HGNC: 9673
Ensembl: ENSG00000149177
Vega: OTTHUMG00000166573
Pharos: Q12913(Tbio)
UniProt: Q12913 Q9NPR5
LinkDB All DBs
Structure
PDB: 

Position
11p11.2
AA seq 1337 aa AA seqDB search
MKPAAREARLPPRSPGLRWALPLLLLLLRLGQILCAGGTPSPIPDPSVATVATGENGITQ
ISSTAESFHKQNGTGTPQVETNTSEDGESSGANDSLRTPEQGSNGTDGASQKTPSSTGPS
PVFDIKAVSISPTNVILTWKSNDTAASEYKYVVKHKMENEKTITVVHQPWCNITGLRPAT
SYVFSITPGIGNETWGDPRVIKVITEPIPVSDLRVALTGVRKAALSWSNGNGTASCRVLL
ESIGSHEELTQDSRLQVNISGLKPGVQYNINPYLLQSNKTKGDPLGTEGGLDASNTERSR
AGSPTAPVHDESLVGPVDPSSGQQSRDTEVLLVGLEPGTRYNATVYSQAANGTEGQPQAI
EFRTNAIQVFDVTAVNISATSLTLIWKVSDNESSSNYTYKIHVAGETDSSNLNVSEPRAV
IPGLRSSTFYNITVCPVLGDIEGTPGFLQVHTPPVPVSDFRVTVVSTTEIGLAWSSHDAE
SFQMHITQEGAGNSRVEITTNQSIIIGGLFPGTKYCFEIVPKGPNGTEGASRTVCNRTVP
SAVFDIHVVYVTTTEMWLDWKSPDGASEYVYHLVIESKHGSNHTSTYDKAITLQGLIPGT
LYNITISPEVDHVWGDPNSTAQYTRPSNVSNIDVSTNTTAATLSWQNFDDASPTYSYCLL
IEKAGNSSNATQVVTDIGITDATVTELIPGSSYTVEIFAQVGDGIKSLEPGRKSFCTDPA
SMASFDCEVVPKEPALVLKWTCPPGANAGFELEVSSGAWNNATHLESCSSENGTEYRTEV
TYLNFSTSYNISITTVSCGKMAAPTRNTCTTGITDPPPPDGSPNITSVSHNSVKVKFSGF
EASHGPIKAYAVILTTGEAGHPSADVLKYTYEDFKKGASDTYVTYLIRTEEKGRSQSLSE
VLKYEIDVGNESTTLGYYNGKLEPLGSYRACVAGFTNITFHPQNKGLIDGAESYVSFSRY
SDAVSLPQDPGVICGAVFGCIFGALVIVTVGGFIFWRKKRKDAKNNEVSFSQIKPKKSKL
IRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDIS
RVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTK
CVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHF
TSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIE
NENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIY
ENLAPVTTFGKTNGYIA
NT seq 4014 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggcggcgcgggaggcgcggctgcctccgcgctcgcccgggctgcgctgggcg
ctgccgctgctgctgctgctgctgcgcctgggccagatcctgtgcgcaggtggcacccct
agtccaattcctgacccttcagtagcaactgttgccacaggggaaaatggcataacgcag
atcagcagtacagcagaatcctttcataaacagaatggaactggaacacctcaggtggaa
acaaacaccagtgaggatggtgaaagctctggagccaacgatagtttaagaacacctgaa
caaggatctaatgggactgatggggcatctcaaaaaactcccagtagcactgggcccagt
cctgtgtttgacattaaagctgtttccatcagtccaaccaatgtgatcttaacttggaaa
agtaatgacacagctgcttctgagtacaagtatgtagtaaagcataagatggaaaatgag
aagacaattactgttgtgcatcaaccatggtgtaacatcacaggcttacgtccagcgact
tcatatgtattctccatcactccaggaataggcaatgagacttggggagatcccagagtc
ataaaagtcatcacagagccgatcccagtttctgatctccgtgttgccctcacgggtgtg
aggaaggctgctctctcctggagcaatggcaatggcactgcctcctgccgggttcttctt
gaaagcattggaagccatgaggagttgactcaagactcaagacttcaggtcaatatctcg
ggcctgaagccaggggttcaatacaacatcaacccgtatcttctacaatcaaataagaca
aagggagaccccttgggcacagaaggtggcttggatgccagcaatacagagagaagccgg
gcagggagccccaccgcccctgtgcatgatgagtccctcgtgggacctgtggacccatcc
tccggccagcagtcccgagacacggaagtcctgcttgtcgggttagagcctggcacccga
tacaatgccaccgtttattcccaagcagcgaatggcacagaaggacagccccaggccata
gagttcaggacaaatgctattcaggtttttgacgtcaccgctgtgaacatcagtgccaca
agcctgaccctgatctggaaagtcagcgataacgagtcgtcatctaactatacctacaag
atacatgtggcgggggagacagattcttccaatctcaacgtcagtgagcctcgcgctgtc
atccccggactccgctccagcaccttctacaacatcacagtgtgtcctgtcctaggtgac
atcgagggcacgccgggcttcctccaagtgcacaccccccctgttccagtttctgacttc
cgagtgacagtggtcagcacgacggagatcggcttagcatggagcagccatgatgcagaa
tcatttcagatgcatatcacacaggagggagctggcaattctcgggtagaaataaccacc
aaccaaagtattatcattggtggcttgttccctggaaccaagtattgctttgaaatagtt
ccaaaaggaccaaatgggactgaaggggcatctcggacagtttgcaatagaactgttccc
agtgcagtgtttgacatccacgtggtctacgtcaccaccacggagatgtggctggactgg
aagagccctgacggtgcttccgagtatgtctaccatttagtcatagagtccaagcatggc
tctaaccacacaagcacgtatgacaaagcgattactctccagggcctgattccgggcacc
ttatataacatcaccatctctccagaagtggaccacgtctggggggaccccaactccact
gcacagtacacacggcccagcaatgtgtccaacattgatgtaagtaccaacaccacagca
gcaactttaagttggcagaactttgatgacgcctctcccacgtactcctactgccttctt
attgagaaggctggaaattccagcaacgcaacacaagtagtcacggacattggaattact
gacgctacagtcactgaattaatacctggctcatcatacacagtggagatctttgcacaa
gtaggggatgggatcaagtcactggaacctggccggaagtcattctgtacagatcctgcg
tccatggcctccttcgactgcgaagtggtccccaaagagccagccctggttctcaaatgg
acctgccctcctggcgccaatgcaggctttgagctggaggtcagcagtggagcctggaac
aatgcgacccacctggagagctgctcctctgagaatggcactgagtatagaacggaagtc
acgtatttgaatttttctacctcgtacaacatcagcatcaccactgtgtcctgtggaaag
atggcagcccccacccggaacacctgcactactggcatcacagatccccctcctccagat
ggatcccctaatattacatctgtcagtcacaattcagtaaaggtcaagttcagtggattt
gaagccagccacggacccatcaaagcctatgctgtcattctcaccaccggggaagctggt
cacccttctgcagatgtcctgaaatacacgtatgaggatttcaaaaagggagcctcagat
acttatgtgacatacctcataagaacagaagaaaagggacgttctcagagcttgtctgaa
gttttgaaatatgaaattgacgttgggaatgagtcaaccacacttggttattacaatggg
aagctggaacctctgggctcctaccgggcttgtgtggctggcttcaccaacattaccttc
caccctcaaaacaaggggctcattgatggggctgagagctatgtgtccttcagtcgctac
tcagatgctgtttccttgccccaggatccaggtgtcatctgtggagcggtttttggctgt
atctttggtgccctggttattgtgactgtgggaggcttcatcttctggagaaagaagagg
aaagatgcaaagaataatgaagtgtccttttctcaaattaaacctaaaaaatctaagtta
atcagagtggagaattttgaggcctacttcaagaagcagcaagctgactccaactgtggg
ttcgcagaggaatacgaagatctgaagcttgttggaattagtcaacctaaatatgcagca
gaactggctgagaatagaggaaagaatcgctataataatgttctgccctatgatatttcc
cgtgtcaaactttcggtccagacccattcaacggatgactacatcaatgccaactacatg
cctggctaccactccaagaaagattttattgccacacaaggacctttaccgaacactttg
aaagatttttggcgtatggtttgggagaaaaatgtatatgccatcattatgttgactaaa
tgtgttgaacagggaagaaccaaatgtgaggagtattggccctccaagcaggctcaggac
tatggagacataactgtggcaatgacatcagaaattgttcttccggaatggaccatcaga
gatttcacagtgaaaaatatccagacaagtgagagtcaccctctgagacagttccatttc
acctcctggccagaccacggtgttcccgacaccactgacctgctcatcaacttccggtac
ctcgttcgtgactacatgaagcagagtcctcccgaatcgccgattctggtgcattgcagt
gctggggtcggaaggacgggcactttcattgccattgatcgtctcatctaccagatagag
aatgagaacaccgtggatgtgtatgggattgtgtatgaccttcgaatgcataggccttta
atggtgcagacagaggaccagtatgttttcctcaatcagtgtgttttggatattgtcaga
tcccagaaagactcaaaagtagatcttatctaccagaacacaactgcaatgacaatctat
gaaaaccttgcgcccgtgaccacatttggaaagaccaatggttacatcgcctaa

DBGET integrated database retrieval system