KEGG   Homo sapiens (human): 5805
Entry
5805              CDS       T01001                                 

Gene name
PTS, PTPS
Definition
(RefSeq) 6-pyruvoyltetrahydropterin synthase
  KO
K01737  6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00842  Tetrahydrobiopterin biosynthesis, GTP => BH4
Network
nt06016  Phenylalanine and tyrosine metabolism
  Element
N00702  Tetrahydrobiopterin biosynthesis, GTP to BH4
N00703  PTS deficiency in tetrahydrobiopterin biosynthesis
Disease
H00167  Phenylketonuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    5805 (PTS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    5805 (PTS)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.50  6-carboxytetrahydropterin synthase
     5805 (PTS)
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     5805 (PTS)
Transfer RNA biogenesis [BR:hsa03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    5805 (PTS)
SSDB
Motif
Pfam: PTPS
Other DBs
NCBI-GeneID: 5805
NCBI-ProteinID: NP_000308
OMIM: 612719
HGNC: 9689
Ensembl: ENSG00000150787
Vega: OTTHUMG00000167167
Pharos: Q03393(Tbio)
UniProt: Q03393
LinkDB
Structure
PDB: 
3I2B

Position
11q23.1
AA seq 145 aa
MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVH
GEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQK
VLPVGVLYKVKVYETDNNIVVYKGE
NT seq 438 nt   +upstreamnt  +downstreamnt
atgagcacggaaggtggtggccgtcgctgccaggcacaagtgtcccgccgcatctccttc
agcgcgagccaccgattgtacagtaaatttctaagtgatgaagaaaacttgaaactgttt
gggaaatgcaacaatccaaatggccatgggcacaattataaagttgtggtgacagtacat
ggagagattgaccctgctacgggaatggttatgaatctggctgatctcaaaaaatatatg
gaggaggcgattatgcagccccttgatcataagaatctggatatggatgtgccatacttt
gcagatgtggtgagcacgactgaaaatgtagctgtttatatctgggacaacctccagaaa
gttcttcctgtaggagttctttataaagtaaaagtatacgaaactgacaataatattgtg
gtttataaaggagaatag

DBGET integrated database retrieval system