KEGG   Homo sapiens (human): 58476
Entry
58476             CDS       T01001                                 

Gene name
TP53INP2, C20orf110, DOR, PIG-U, PIGU, PINH, dJ1181N3.1
Definition
(RefSeq) tumor protein p53 inducible nuclear protein 2
  KO
K21247  tumor protein p53-inducible nuclear protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    58476 (TP53INP2)
SSDB
Motif
Pfam: DOR
Other DBs
NCBI-GeneID: 58476
NCBI-ProteinID: NP_001316358
OMIM: 617549
HGNC: 16104
Ensembl: ENSG00000078804
Vega: OTTHUMG00000032310
Pharos: Q8IXH6(Tbio)
UniProt: Q8IXH6
LinkDB
Position
20q11.22
AA seq 220 aa
MFQRLSSLFFSTPSPPEDPDCPRAFVSEEDEVDGWLIIDLPDSYAAPPSPGAAPAPAGRP
PPAPSLMDESWFVTPPACFTAEGPGLGPARLQSSPLEDLLIEHPSMSVYVTGSTIVLEPG
SPSPLPDAALPDGDLSEGELTPARREPRAARHAAPLPARAALLEKAGQVRRLQRARQRAE
RHALSAKAVQRQNRARESRPRRSKNQSSFIYQPCQRQFNY
NT seq 663 nt   +upstreamnt  +downstreamnt
atgttccagcgcctctccagcctcttcttcagcaccccctcgccccccgaagaccccgac
tgcccccgcgccttcgtgtcggaggaggatgaagtggacggctggctcatcattgacctg
ccggacagctacgcggctccacccagccccggggccgcccctgcccccgcgggccgccct
ccgcccgcgccctccttgatggacgagagctggtttgttacccctcccgcctgttttacg
gcagaggggcctggactcggtcccgcccgcctccagagcagtcccctggaggacctcctc
atcgagcaccccagcatgtccgtttacgtcaccggcagcaccatagtgctagagcccggg
tccccttccccgctcccggacgcggccctgcctgacggcgacctcagcgaaggggaattg
acgcccgcccgccgcgagccgcgggccgcgcgccacgccgctcctctcccagcgcgggcg
gcgctgctggagaaggcgggccaggtgcggcggctgcagcgggcccggcagcgggcagag
cgccacgcgctgagcgccaaggcggtgcagcggcagaaccgagcccgcgagagccgtccg
cgccggtccaagaaccagagcagcttcatctaccagccgtgccagcgccagttcaactac
tga

DBGET integrated database retrieval system