KEGG   Homo sapiens (human): 58484
Entry
58484             CDS       T01001                                 

Gene name
NLRC4, AIFEC, CARD12, CLAN, CLAN1, CLANA, CLANB, CLANC, CLAND, CLR2.1, FCAS4, IPAF
Definition
(RefSeq) NLR family CARD domain containing 4
  KO
K12805  NLR family CARD domain-containing protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05134  Legionellosis
hsa05135  Yersinia infection
Network
nt06139  NLR signaling (viruses and bacteria)
  Element
N00865  Yersinia YopK to NLRC4 Inflammasome signaling pathway
N00867  NLRC4 Inflammasome signaling pathway
N00949  Shigella IpaB to NLRC4 Inflammasome signaling pathway
Disease
H01748  Autoinflammation with infantile enterocolitis
H02159  Familial cold autoinflammatory syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    58484 (NLRC4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    58484 (NLRC4)
   05131 Shigellosis
    58484 (NLRC4)
   05135 Yersinia infection
    58484 (NLRC4)
   05134 Legionellosis
    58484 (NLRC4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    58484 (NLRC4)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   58484 (NLRC4)
SSDB
Motif
Pfam: NACHT NLRC4_HD CARD AAA_16
Other DBs
NCBI-GeneID: 58484
NCBI-ProteinID: NP_001186067
OMIM: 606831
HGNC: 16412
Ensembl: ENSG00000091106
Vega: OTTHUMG00000152107
Pharos: Q9NPP4(Tbio)
UniProt: Q9NPP4
LinkDB
Structure
PDB: 
6N1I

Position
2p22.3
AA seq 1024 aa
MNFIKDNSRALIQRMGMTVIKQITDDLFVWNVLNREEVNIICCEKVEQDAARGIIHMILK
KGSESCNLFLKSLKEWNYPLFQDLNGQSLFHQTSEGDLDDLAQDLKDLYHTPSFLNFYPL
GEDIDIIFNLKSTFTEPVLWRKDQHHHRVEQLTLNGLLQALQSPCIIEGESGKGKSTLLQ
RIAMLWGSGKCKALTKFKFVFFLRLSRAQGGLFETLCDQLLDIPGTIRKQTFMAMLLKLR
QRVLFLLDGYNEFKPQNCPEIEALIKENHRFKNMVIVTTTTECLRHIRQFGALTAEVGDM
TEDSAQALIREVLIKELAEGLLLQIQKSRCLRNLMKTPLFVVITCAIQMGESEFHSHTQT
TLFHTFYDLLIQKNKHKHKGVAASDFIRSLDHCGDLALEGVFSHKFDFELQDVSSVNEDV
LLTTGLLCKYTAQRFKPKYKFFHKSFQEYTAGRRLSSLLTSHEPEEVTKGNGYLQKMVSI
SDITSTYSSLLRYTCGSSVEATRAVMKHLAAVYQHGCLLGLSIAKRPLWRQESLQSVKNT
TEQEILKAININSFVECGIHLYQESTSKSALSQEFEAFFQGKSLYINSGNIPDYLFDFFE
HLPNCASALDFIKLDFYGGAMASWEKAAEDTGGIHMEEAPETYIPSRAVSLFFNWKQEFR
TLEVTLRDFSKLNKQDIRYLGKIFSSATSLRLQIKRCAGVAGSLSLVLSTCKNIYSLMVE
ASPLTIEDERHITSVTNLKTLSIHDLQNQRLPGGLTDSLGNLKNLTKLIMDNIKMNEEDA
IKLAEGLKNLKKMCLFHLTHLSDIGEGMDYIVKSLSSEPCDLEEIQLVSCCLSANAVKIL
AQNLHNLVKLSILDLSENYLEKDGNEALHELIDRMNVLEQLTALMLPWGCDVQGSLSSLL
KHLEEVPQLVKLGLKNWRLTDTEIRILGAFFGKNPLKNFQQLNLAGNRVSSDGWLAFMGV
FENLKQLVFFDFSTKEFLPDPALVRKLSQVLSKLTFLQEARLVGWQFDDDDLSVITGAFK
LVTA
NT seq 3075 nt   +upstreamnt  +downstreamnt
atgaatttcataaaggacaatagccgagcccttattcaaagaatgggaatgactgttata
aagcaaatcacagatgacctatttgtatggaatgttctgaatcgcgaagaagtaaacatc
atttgctgcgagaaggtggagcaggatgctgctagagggatcattcacatgattttgaaa
aagggttcagagtcctgtaacctctttcttaaatcccttaaggagtggaactatcctcta
tttcaggacttgaatggacaaagtctttttcatcagacatcagaaggagacttggacgat
ttggctcaggatttaaaggacttgtaccataccccatcttttctgaacttttatcccctt
ggtgaagatattgacattatttttaacttgaaaagcaccttcacagaacctgtcctgtgg
aggaaggaccaacaccatcaccgcgtggagcagctgaccctgaatggcctcctgcaggct
cttcagagcccctgcatcattgaaggggaatctggcaaaggcaagtccactctgctgcag
cgaattgccatgctctggggctccggaaagtgcaaggctctgaccaagttcaaattcgtc
ttcttcctccgtctcagcagggcccagggtggactttttgaaaccctctgtgatcaactc
ctggatatacctggcacaatcaggaagcagacattcatggccatgctgctgaagctgcgg
cagagggttcttttccttcttgatggctacaatgaattcaagccccagaactgcccagaa
atcgaagccctgataaaggaaaaccaccgcttcaagaacatggtcatcgtcaccactacc
actgagtgcctgaggcacatacggcagtttggtgccctgactgctgaggtgggggatatg
acagaagacagcgcccaggctctcatccgagaagtgctgatcaaggagcttgctgaaggc
ttgttgctccaaattcagaaatccaggtgcttgaggaatctcatgaagacccctctcttt
gtggtcatcacttgtgcaatccagatgggtgaaagtgagttccactctcacacacaaaca
acgctgttccataccttctatgatctgttgatacagaaaaacaaacacaaacataaaggt
gtggctgcaagtgacttcattcggagcctggaccactgtggagacctagctctggagggt
gtgttctcccacaagtttgatttcgaactgcaggatgtgtccagcgtgaatgaggatgtc
ctgctgacaactgggctcctctgtaaatatacagctcaaaggttcaagccaaagtataaa
ttctttcacaagtcattccaggagtacacagcaggacgaagactcagcagtttattgacg
tctcatgagccagaggaggtgaccaaggggaatggttacttgcagaaaatggtttccatt
tcggacattacatccacttatagcagcctgctccggtacacctgtgggtcatctgtggaa
gccaccagggctgttatgaagcacctcgcagcagtgtatcaacacggctgccttctcgga
ctttccatcgccaagaggcctctctggagacaggaatctttgcaaagtgtgaaaaacacc
actgagcaagaaattctgaaagccataaacatcaattcctttgtagagtgtggcatccat
ttatatcaagagagtacatccaaatcagccctgagccaagaatttgaagctttctttcaa
ggtaaaagcttatatatcaactcagggaacatccccgattacttatttgacttctttgaa
catttgcccaattgtgcaagtgccctggacttcattaaactggacttttatgggggagct
atggcttcatgggaaaaggctgcagaagacacaggtggaatccacatggaagaggcccca
gaaacctacattcccagcagggctgtatctttgttcttcaactggaagcaggaattcagg
actctggaggtcacactccgggatttcagcaagttgaataagcaagatatcagatatctg
gggaaaatattcagctctgccacaagcctcaggctgcaaataaagagatgtgctggtgtg
gctggaagcctcagtttggtcctcagcacctgtaagaacatttattctctcatggtggaa
gccagtcccctcaccatagaagatgagaggcacatcacatctgtaacaaacctgaaaacc
ttgagtattcatgacctacagaatcaacggctgccgggtggtctgactgacagcttgggt
aacttgaagaaccttacaaagctcataatggataacataaagatgaatgaagaagatgct
ataaaactagctgaaggcctgaaaaacctgaagaagatgtgtttatttcatttgacccac
ttgtctgacattggagagggaatggattacatagtcaagtctctgtcaagtgaaccctgt
gaccttgaagaaattcaattagtctcctgctgcttgtctgcaaatgcagtgaaaatccta
gctcagaatcttcacaatttggtcaaactgagcattcttgatttatcagaaaattacctg
gaaaaagatggaaatgaagctcttcatgaactgatcgacaggatgaacgtgctagaacag
ctcaccgcactgatgctgccctggggctgtgacgtgcaaggcagcctgagcagcctgttg
aaacatttggaggaggtcccacaactcgtcaagcttgggttgaaaaactggagactcaca
gatacagagattagaattttaggtgcattttttggaaagaaccctctgaaaaacttccag
cagttgaatttggcgggaaatcgtgtgagcagtgatggatggcttgccttcatgggtgta
tttgagaatcttaagcaattagtgttttttgactttagtactaaagaatttctacctgat
ccagcattagtcagaaaacttagccaagtgttatccaagttaacttttctgcaagaagct
aggcttgttgggtggcaatttgatgatgatgatctcagtgttattacaggtgcttttaaa
ctagtaactgcttaa

DBGET integrated database retrieval system