KEGG   Homo sapiens (human): 58484
Entry
58484             CDS       T01001                                 

Gene name
NLRC4, AIFEC, CARD12, CLAN, CLAN1, CLANA, CLANB, CLANC, CLAND, CLR2.1, FCAS4, IPAF
Definition
(RefSeq) NLR family CARD domain containing 4
  KO
K12805  NLR family CARD domain-containing protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05134  Legionellosis
hsa05135  Yersinia infection
Network
nt06139  NLR signaling (viruses and bacteria)
  Element
N00865  Yersinia YopK to NLRC4 Inflammasome signaling pathway
N00867  NLRC4 Inflammasome signaling pathway
N00949  Shigella IpaB to NLRC4 Inflammasome signaling pathway
Disease
H01748  Autoinflammation with infantile enterocolitis
H02159  Familial cold autoinflammatory syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    58484 (NLRC4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    58484 (NLRC4)
   05131 Shigellosis
    58484 (NLRC4)
   05135 Yersinia infection
    58484 (NLRC4)
   05134 Legionellosis
    58484 (NLRC4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    58484 (NLRC4)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   58484 (NLRC4)
SSDB
Motif
Pfam: NACHT NLRC4_HD CARD AAA_16
Other DBs
NCBI-GeneID: 58484
NCBI-ProteinID: NP_001186067
OMIM: 606831
HGNC: 16412
Ensembl: ENSG00000091106
Vega: OTTHUMG00000152107
Pharos: Q9NPP4(Tbio)
UniProt: Q9NPP4
LinkDB
Structure
PDB: 
6N1I

Position
2p22.3
AA seq 1024 aa
MNFIKDNSRALIQRMGMTVIKQITDDLFVWNVLNREEVNIICCEKVEQDAARGIIHMILK
KGSESCNLFLKSLKEWNYPLFQDLNGQSLFHQTSEGDLDDLAQDLKDLYHTPSFLNFYPL
GEDIDIIFNLKSTFTEPVLWRKDQHHHRVEQLTLNGLLQALQSPCIIEGESGKGKSTLLQ
RIAMLWGSGKCKALTKFKFVFFLRLSRAQGGLFETLCDQLLDIPGTIRKQTFMAMLLKLR
QRVLFLLDGYNEFKPQNCPEIEALIKENHRFKNMVIVTTTTECLRHIRQFGALTAEVGDM
TEDSAQALIREVLIKELAEGLLLQIQKSRCLRNLMKTPLFVVITCAIQMGESEFHSHTQT
TLFHTFYDLLIQKNKHKHKGVAASDFIRSLDHCGDLALEGVFSHKFDFELQDVSSVNEDV
LLTTGLLCKYTAQRFKPKYKFFHKSFQEYTAGRRLSSLLTSHEPEEVTKGNGYLQKMVSI
SDITSTYSSLLRYTCGSSVEATRAVMKHLAAVYQHGCLLGLSIAKRPLWRQESLQSVKNT
TEQEILKAININSFVECGIHLYQESTSKSALSQEFEAFFQGKSLYINSGNIPDYLFDFFE
HLPNCASALDFIKLDFYGGAMASWEKAAEDTGGIHMEEAPETYIPSRAVSLFFNWKQEFR
TLEVTLRDFSKLNKQDIRYLGKIFSSATSLRLQIKRCAGVAGSLSLVLSTCKNIYSLMVE
ASPLTIEDERHITSVTNLKTLSIHDLQNQRLPGGLTDSLGNLKNLTKLIMDNIKMNEEDA
IKLAEGLKNLKKMCLFHLTHLSDIGEGMDYIVKSLSSEPCDLEEIQLVSCCLSANAVKIL
AQNLHNLVKLSILDLSENYLEKDGNEALHELIDRMNVLEQLTALMLPWGCDVQGSLSSLL
KHLEEVPQLVKLGLKNWRLTDTEIRILGAFFGKNPLKNFQQLNLAGNRVSSDGWLAFMGV
FENLKQLVFFDFSTKEFLPDPALVRKLSQVLSKLTFLQEARLVGWQFDDDDLSVITGAFK
LVTA
NT seq 3075 nt   +upstreamnt  +downstreamnt
atgaatttcataaaggacaatagccgagcccttattcaaagaatgggaatgactgttata
aagcaaatcacagatgacctatttgtatggaatgttctgaatcgcgaagaagtaaacatc
atttgctgcgagaaggtggagcaggatgctgctagagggatcattcacatgattttgaaa
aagggttcagagtcctgtaacctctttcttaaatcccttaaggagtggaactatcctcta
tttcaggacttgaatggacaaagtctttttcatcagacatcagaaggagacttggacgat
ttggctcaggatttaaaggacttgtaccataccccatcttttctgaacttttatcccctt
ggtgaagatattgacattatttttaacttgaaaagcaccttcacagaacctgtcctgtgg
aggaaggaccaacaccatcaccgcgtggagcagctgaccctgaatggcctcctgcaggct
cttcagagcccctgcatcattgaaggggaatctggcaaaggcaagtccactctgctgcag
cgaattgccatgctctggggctccggaaagtgcaaggctctgaccaagttcaaattcgtc
ttcttcctccgtctcagcagggcccagggtggactttttgaaaccctctgtgatcaactc
ctggatatacctggcacaatcaggaagcagacattcatggccatgctgctgaagctgcgg
cagagggttcttttccttcttgatggctacaatgaattcaagccccagaactgcccagaa
atcgaagccctgataaaggaaaaccaccgcttcaagaacatggtcatcgtcaccactacc
actgagtgcctgaggcacatacggcagtttggtgccctgactgctgaggtgggggatatg
acagaagacagcgcccaggctctcatccgagaagtgctgatcaaggagcttgctgaaggc
ttgttgctccaaattcagaaatccaggtgcttgaggaatctcatgaagacccctctcttt
gtggtcatcacttgtgcaatccagatgggtgaaagtgagttccactctcacacacaaaca
acgctgttccataccttctatgatctgttgatacagaaaaacaaacacaaacataaaggt
gtggctgcaagtgacttcattcggagcctggaccactgtggagacctagctctggagggt
gtgttctcccacaagtttgatttcgaactgcaggatgtgtccagcgtgaatgaggatgtc
ctgctgacaactgggctcctctgtaaatatacagctcaaaggttcaagccaaagtataaa
ttctttcacaagtcattccaggagtacacagcaggacgaagactcagcagtttattgacg
tctcatgagccagaggaggtgaccaaggggaatggttacttgcagaaaatggtttccatt
tcggacattacatccacttatagcagcctgctccggtacacctgtgggtcatctgtggaa
gccaccagggctgttatgaagcacctcgcagcagtgtatcaacacggctgccttctcgga
ctttccatcgccaagaggcctctctggagacaggaatctttgcaaagtgtgaaaaacacc
actgagcaagaaattctgaaagccataaacatcaattcctttgtagagtgtggcatccat
ttatatcaagagagtacatccaaatcagccctgagccaagaatttgaagctttctttcaa
ggtaaaagcttatatatcaactcagggaacatccccgattacttatttgacttctttgaa
catttgcccaattgtgcaagtgccctggacttcattaaactggacttttatgggggagct
atggcttcatgggaaaaggctgcagaagacacaggtggaatccacatggaagaggcccca
gaaacctacattcccagcagggctgtatctttgttcttcaactggaagcaggaattcagg
actctggaggtcacactccgggatttcagcaagttgaataagcaagatatcagatatctg
gggaaaatattcagctctgccacaagcctcaggctgcaaataaagagatgtgctggtgtg
gctggaagcctcagtttggtcctcagcacctgtaagaacatttattctctcatggtggaa
gccagtcccctcaccatagaagatgagaggcacatcacatctgtaacaaacctgaaaacc
ttgagtattcatgacctacagaatcaacggctgccgggtggtctgactgacagcttgggt
aacttgaagaaccttacaaagctcataatggataacataaagatgaatgaagaagatgct
ataaaactagctgaaggcctgaaaaacctgaagaagatgtgtttatttcatttgacccac
ttgtctgacattggagagggaatggattacatagtcaagtctctgtcaagtgaaccctgt
gaccttgaagaaattcaattagtctcctgctgcttgtctgcaaatgcagtgaaaatccta
gctcagaatcttcacaatttggtcaaactgagcattcttgatttatcagaaaattacctg
gaaaaagatggaaatgaagctcttcatgaactgatcgacaggatgaacgtgctagaacag
ctcaccgcactgatgctgccctggggctgtgacgtgcaaggcagcctgagcagcctgttg
aaacatttggaggaggtcccacaactcgtcaagcttgggttgaaaaactggagactcaca
gatacagagattagaattttaggtgcattttttggaaagaaccctctgaaaaacttccag
cagttgaatttggcgggaaatcgtgtgagcagtgatggatggcttgccttcatgggtgta
tttgagaatcttaagcaattagtgttttttgactttagtactaaagaatttctacctgat
ccagcattagtcagaaaacttagccaagtgttatccaagttaacttttctgcaagaagct
aggcttgttgggtggcaatttgatgatgatgatctcagtgttattacaggtgcttttaaa
ctagtaactgcttaa

KEGG   Homo sapiens (human): 29108
Entry
29108             CDS       T01001                                 

Gene name
PYCARD, ASC, CARD5, TMS, TMS-1, TMS1
Definition
(RefSeq) PYD and CARD domain containing
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05135  Yersinia infection
hsa05164  Influenza A
Network
nt06139  NLR signaling (viruses and bacteria)
nt06170  Influenza A virus (IAV)
  Element
N00742  NLRP3 Inflammasome signaling pathway
N00743  IAV NS1 to NLRP3 inflammasome signaling pathway
N00864  Yersinia YopK to NLRP3 Inflammasome signaling pathway
N00865  Yersinia YopK to NLRC4 Inflammasome signaling pathway
N00866  Yersinia YopM to Pyrin Inflammasome signaling pathway
N00867  NLRC4 Inflammasome signaling pathway
N00868  Pyrin Inflammasome signaling pathway
N00933  Escherichia NleA to NLRP3 inflammasome signaling pathway
N00934  Non-canonical inflammasome signaling pathway
N00948  Shigella IpaH7.8 to NLRP3 Inflammasome signaling pathway
N00949  Shigella IpaB to NLRC4 Inflammasome signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    29108 (PYCARD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    29108 (PYCARD)
   04623 Cytosolic DNA-sensing pathway
    29108 (PYCARD)
   04625 C-type lectin receptor signaling pathway
    29108 (PYCARD)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    29108 (PYCARD)
   05132 Salmonella infection
    29108 (PYCARD)
   05131 Shigellosis
    29108 (PYCARD)
   05135 Yersinia infection
    29108 (PYCARD)
   05133 Pertussis
    29108 (PYCARD)
   05134 Legionellosis
    29108 (PYCARD)
  09172 Infectious disease: viral
   05164 Influenza A
    29108 (PYCARD)
SSDB
Motif
Pfam: CARD PYRIN
Other DBs
NCBI-GeneID: 29108
NCBI-ProteinID: NP_037390
OMIM: 606838
HGNC: 16608
Ensembl: ENSG00000103490
Vega: OTTHUMG00000176753
Pharos: Q9ULZ3(Tbio)
UniProt: Q9ULZ3
LinkDB
Structure
PDB: 
6N1H 3J63 5H8O 2KN6 1UCP

Position
16p11.2
AA seq 195 aa
MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFY
LETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRA
ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQA
LRESQSYLVEDLERS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggggcgcgcgcgcgacgccatcctggatgcgctggagaacctgaccgccgaggagctc
aagaagttcaagctgaagctgctgtcggtgccgctgcgcgagggctacgggcgcatcccg
cggggcgcgctgctgtccatggacgccttggacctcaccgacaagctggtcagcttctac
ctggagacctacggcgccgagctcaccgctaacgtgctgcgcgacatgggcctgcaggag
atggccgggcagctgcaggcggccacgcaccagggctctggagccgcgccagctgggatc
caggcccctcctcagtcggcagccaagccaggcctgcactttatagaccagcaccgggct
gcgcttatcgcgagggtcacaaacgttgagtggctgctggatgctctgtacgggaaggtc
ctgacggatgagcagtaccaggcagtgcgggccgagcccaccaacccaagcaagatgcgg
aagctcttcagtttcacaccagcctggaactggacctgcaaggacttgctcctccaggcc
ctaagggagtcccagtcctacctggtggaggacctggagcggagctga

DBGET integrated database retrieval system