Homo sapiens (human): 58498 Help Entry 58498             CDS       T01001                                  Symbol MYL7, MYL2A, MYLC2A Name (RefSeq) myosin light chain 7   KO K12754   myosin regulatory light chain 7 Organism hsa  Homo sapiens (human) Pathway hsa04510   Focal adhesion hsa04520   Adherens junction hsa04670   Leukocyte transendothelial migration hsa04810   Regulation of actin cytoskeleton hsa04814   Motor proteins hsa04820   Cytoskeleton in muscle cells hsa05131   Shigellosis hsa05132   Salmonella infection Network nt06181  Salmonella nt06182  Shigella   Element N01074   Shigella IpaA to ITGA/B-RhoGEF-RhoA signaling pathway N01130   Salmonella SopB to RhoA signaling pathway Brite KEGG Orthology (KO) [BR:hsa00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     58498 (MYL7)    04520 Adherens junction     58498 (MYL7)   09142 Cell motility    04814 Motor proteins     58498 (MYL7)    04820 Cytoskeleton in muscle cells     58498 (MYL7)    04810 Regulation of actin cytoskeleton     58498 (MYL7)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     58498 (MYL7)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     58498 (MYL7)    05131 Shigellosis     58498 (MYL7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hsa04812]     58498 (MYL7) Cytoskeleton proteins [BR:hsa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      58498 (MYL7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 CHCH EF-hand_9 Motif Other DBs NCBI-GeneID:  58498 NCBI-ProteinID:  NP_067046 OMIM:  613993 HGNC:  21719 Ensembl:  ENSG00000106631 UniProt:  Q01449 LinkDB All DBs Position 7:complement(44138864..44141332) Genome browser AA seq 175 aa AA seqDB search MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRET YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG VVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggccagcaggaaggcggggacccggggcaaggtggcagccaccaagcaggcccaacgt ggttcttccaacgtcttttccatgtttgaacaagcccagatacaggagttcaaagaagcc ttcagctgtatcgaccagaatcgtgatggcatcatctgcaaggcagacctgagggagacc tactcccagctggggaaggtgagtgtcccagaggaggagctggacgccatgctgcaagag ggcaagggccccatcaacttcaccgtcttcctcacgctctttggggagaagctcaatggg acagaccccgaggaagccatcctgagtgccttccgcatgtttgaccccagcggcaaaggg gtggtgaacaaggatgagttcaagcagcttctcctgacccaggcagacaagttctctcca gctgaggtggagcagatgttcgccctgacacccatggacctggcggggaacatcgactac aagtcactgtgctacatcatcacccatggagacgagaaagaggaatga

DBGET integrated database retrieval system