KEGG   Homo sapiens (human): 58538
Entry
58538             CDS       T01001                                 

Gene name
MPP4, ALS2CR5, DLG6
Definition
(RefSeq) membrane palmitoylated protein 4
  KO
K21109  MAGUK p55 subfamily member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    58538 (MPP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    58538 (MPP4)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 PDZ domain-containing proteins
  MAGUK family proteins
   58538 (MPP4)
SSDB
Motif
Pfam: Guanylate_kin L27 PDZ PDZ_6 SH3_1 SH3_2 SH3_9 PDZ_2 PRP38 Tubulin
Other DBs
NCBI-GeneID: 58538
NCBI-ProteinID: NP_149055
OMIM: 606575
HGNC: 13680
Ensembl: ENSG00000082126
Vega: OTTHUMG00000154525
Pharos: Q96JB8(Tdark)
UniProt: Q96JB8
LinkDB
Position
2q33.1
AA seq 637 aa
MIQSDKGADPPDKKDMKLSTATNPQNGLSQILRLVLQELSLFYGRDVNGVCLLYDLLHSP
WLQALLKIYDCLQEFKEKKLVPATPHAQVLSYEVVELLRETPTSPEIQELRQMLQAPHFK
ALLSAHDTIAQKDFEPLLPPLPDNIPESEEAMRIVCLVKNQQPLGATIKRHEMTGDILVA
RIIHGGLAERSGLLYAGDKLVEVNGVSVEGLDPEQVIHILAMSRGTIMFKVVPVSDPPVN
SQQMVYVRAMTEYWPQEDPDIPCMDAGLPFQKGDILQIVDQNDALWWQARKISDPATCAG
LVPSNHLLKRKQREFWWSQPYQPHTCLKSTLSISMEEEDDMKIDEKCVEADEETFESEEL
SEDKEEFVGYGQKFFIAGFRRSMRLCRRKSHLSPLHASVCCTGSCYSAVGAPYEEVVRYQ
RRPSDKYRLIVLMGPSGVGVNELRRQLIEFNPSHFQSAVPHTTRTKKSYEMNGREYHYVS
KETFENLIYSHRMLEYGEYKGHLYGTSVDAVQTVLVEGKICVMDLEPQDIQGVRTHELKP
YVIFIKPSNMRCMKQSRKNAKVITDYYVDMKFKDEDLQEMENLAQRMETQFGQFFDHVIV
NDSLHDACAQLLSAIQKAQEEPQWVPATWISSDTESQ
NT seq 1914 nt   +upstreamnt  +downstreamnt
atgatacagtcagacaaaggagcagatccaccagacaagaaggacatgaagctttctaca
gccaccaatccacagaatggcctctcccagatcctgaggcttgtgctgcaagagctgagt
ctgttctacggcagagatgtgaatggagtgtgtctcttgtacgatctcctccactcgccg
tggcttcaggctctgctaaagatttatgactgcctccaggaatttaaagaaaagaaacta
gttcctgccacaccacatgcacaggtgttatcctatgaggtagtggagttattacgtgaa
acccctacttcccctgagatccaagagctgagacaaatgctccaggctccacacttcaag
gccttgctcagtgcccatgacacgatagctcagaaagattttgaaccccttctccctcca
ctgccagacaatatccctgagagtgaggaagcaatgaggattgtttgtttagtgaaaaac
caacagcccctgggagccaccatcaagcgccacgagatgacaggggacatcttggtggcc
aggatcatccacggtgggctggcggagagaagtgggttgctatatgctggagacaaactg
gtagaagtgaatggagtttcagttgagggactggaccctgaacaagtgatccatattctg
gccatgtctcgaggcacaatcatgttcaaggtggttccagtctctgaccctcctgtgaat
agccagcagatggtgtacgtccgtgccatgactgagtactggccccaggaggatcccgac
atcccctgcatggacgctggattgcctttccagaagggggacatcctccagattgtggac
cagaatgatgccctctggtggcaggcccgaaaaatctcagaccctgctacctgcgctggg
cttgtcccttctaaccaccttctgaagaggaagcaacgggaattctggtggtctcagccg
taccagcctcacacctgcctcaagtcaaccctatcaatttctatggaagaagaagatgac
atgaagattgatgagaaatgtgtggaagcagatgaagaaacatttgaatctgaggaactt
tcagaagacaaggaggagtttgttggctacggtcagaagttctttatagctggcttccgc
cgcagcatgcgcctttgtcgcaggaagtctcacctcagcccgctgcatgccagtgtgtgc
tgcaccggcagctgctacagtgcagtgggtgccccttacgaggaggtggtgaggtaccag
cgacgcccttcagacaagtaccgcctcatagtgctcatgggaccctctggtgttggagta
aatgagctcagaagacaacttattgaatttaatcccagccattttcaaagtgctgtgcca
cacactactcgtactaaaaagagttacgaaatgaatgggcgtgagtatcactatgtgtcc
aaggaaacatttgaaaacctcatatatagtcacaggatgctggagtatggtgagtacaaa
ggccacctgtatggcactagtgtggatgctgttcaaacagtccttgtcgaaggaaagatc
tgtgtcatggacctagagcctcaggatattcaaggggttcgaacccatgaactgaagccc
tatgtcatatttataaagccatcgaatatgaggtgtatgaaacaatctcggaaaaatgcc
aaggttattactgactactatgtggacatgaagttcaaggatgaagacctacaagagatg
gaaaatttagcccaaagaatggaaactcagtttggccaattttttgatcatgtgattgtg
aatgacagcttgcacgatgcatgtgcccagttgttgtctgccatacagaaggctcaggag
gagcctcagtgggtaccagcaacatggatttcctcagatactgagtctcaatga

DBGET integrated database retrieval system