KEGG   Homo sapiens (human): 5861
Entry
5861              CDS       T01001                                 

Gene name
RAB1A, RAB1, YPT1
Definition
(RefSeq) RAB1A, member RAS oncogene family
  KO
K07874  Ras-related protein Rab-1A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05134  Legionellosis
Network
nt06125  Membrane trafficking (bacteria)
nt06413  Autophagy
nt06464  Amyotrophic lateral sclerosis
  Element
N01142  C9orf72-mediated autophagy initiation
N01143  Mutation-inactivated C9orf72 to C9orf72-mediated autophagy initiation
N01291  TRAPPI-RAB1 signaling pathway
N01292  Escherichia EspG to RAB1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5861 (RAB1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    5861 (RAB1A)
   05022 Pathways of neurodegeneration - multiple diseases
    5861 (RAB1A)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    5861 (RAB1A)
   05134 Legionellosis
    5861 (RAB1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5861 (RAB1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5861 (RAB1A)
   04031 GTP-binding proteins [BR:hsa04031]
    5861 (RAB1A)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    5861 (RAB1A)
 Autophagy
  Other autophagy associated proteins
    5861 (RAB1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5861 (RAB1A)
  Exosomal proteins of other body fluids (saliva and urine)
   5861 (RAB1A)
  Exosomal proteins of colorectal cancer cells
   5861 (RAB1A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab1/35 [OT]
    5861 (RAB1A)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 SRPRB Gtr1_RagA AAA FeoB_N AAA_16 PduV-EutP AAA_7 AAA_29 AAA_22 ABC_tran Septin AAA_5 LANC_like TniB
Other DBs
NCBI-GeneID: 5861
NCBI-ProteinID: NP_004152
OMIM: 179508
HGNC: 9758
Ensembl: ENSG00000138069
Vega: OTTHUMG00000152725
Pharos: P62820(Tbio)
UniProt: P62820 Q5U0I6
LinkDB
Structure
PDB: 

Position
2p14
AA seq 205 aa
MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI
KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL
LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGA
TAGGAEKSNVKIQSTPVKQSGGGCC
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtccagcatgaatcccgaatatgattatttattcaagttacttctgattggcgactca
ggggttggaaagtcttgccttcttcttaggtttgcagatgatacatatacagaaagctac
atcagcacaattggtgtggatttcaaaataagaactatagagttagacgggaaaacaatc
aagcttcaaatatgggacacagcaggccaggaaagatttcgaacaatcacctccagttat
tacagaggagcccatggcatcatagttgtgtatgatgtgacagatcaggagtccttcaat
aatgttaaacagtggctgcaggaaatagatcgttatgccagtgaaaatgtcaacaaattg
ttggtagggaacaaatgtgatctgaccacaaagaaagtagtagactacacaacagcgaag
gaatttgctgattcccttggaattccgtttttggaaaccagtgctaagaatgcaacgaat
gtagaacagtctttcatgacgatggcagctgagattaaaaagcgaatgggtcccggagca
acagctggtggtgctgagaagtccaatgttaaaattcagagcactccagtcaagcagtca
ggtggaggttgctgctaa

KEGG   Homo sapiens (human): 81876
Entry
81876             CDS       T01001                                 

Gene name
RAB1B
Definition
(RefSeq) RAB1B, member RAS oncogene family
  KO
K07875  Ras-related protein Rab-1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05134  Legionellosis
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01291  TRAPPI-RAB1 signaling pathway
N01292  Escherichia EspG to RAB1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    81876 (RAB1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    81876 (RAB1B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    81876 (RAB1B)
   04031 GTP-binding proteins [BR:hsa04031]
    81876 (RAB1B)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    81876 (RAB1B)
 Autophagy
  Other autophagy associated proteins
    81876 (RAB1B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   81876 (RAB1B)
  Exosomal proteins of other body fluids (saliva and urine)
   81876 (RAB1B)
  Exosomal proteins of colorectal cancer cells
   81876 (RAB1B)
  Exosomal proteins of bladder cancer cells
   81876 (RAB1B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab1/35 [OT]
    81876 (RAB1B)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase MMR_HSR1 SRPRB Gtr1_RagA GTP_EFTU AAA FeoB_N AAA_7 AAA_16 ABC_tran AAA_22 PduV-EutP AAA_29 Septin AAA_5 TniB
Other DBs
NCBI-GeneID: 81876
NCBI-ProteinID: NP_112243
OMIM: 612565
HGNC: 18370
Ensembl: ENSG00000174903
Vega: OTTHUMG00000166916
Pharos: Q9H0U4(Tbio)
UniProt: Q9H0U4
LinkDB
Structure
PDB: 

Position
11q13.2
AA seq 201 aa
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ
IWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVG
NKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASG
GERPNLKIDSTPVKPAGGGCC
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaaccccgaatatgactacctgtttaagctgcttttgattggcgactcaggcgtgggc
aagtcatgcctgctcctgcggtttgctgatgacacgtacacagagagctacatcagcacc
atcggggtggacttcaagatccgaaccatcgagctggatggcaaaactatcaaacttcag
atctgggacacagcgggccaggaacggttccggaccatcacttccagctactaccggggg
gctcatggcatcatcgtggtgtatgacgtcactgaccaggaatcctacgccaacgtgaag
cagtggctgcaggagattgaccgctatgccagcgagaacgtcaataagctcctggtgggc
aacaagagcgacctcaccaccaagaaggtggtggacaacaccacagccaaggagtttgca
gactctctgggcatccccttcttggagacgagcgccaagaatgccaccaatgtcgagcag
gcgttcatgaccatggctgctgaaatcaaaaagcggatggggcctggagcagcctctggg
ggcgagcggcccaatctcaagatcgacagcacccctgtaaagccggctggcggtggctgt
tgctag

DBGET integrated database retrieval system