KEGG   Homo sapiens (human): 5863Help
Entry
5863              CDS       T01001                                 

Gene name
RGL2, HKE1.5, KE1.5, RAB2L
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator like 2
  KO
K17636  ral guanine nucleotide dissociation stimulator-like 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5863 (RGL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RA
Motif
Other DBs
NCBI-GeneID: 5863
NCBI-ProteinID: NP_004752
OMIM: 602306
HGNC: 9769
Ensembl: ENSG00000237441
Vega: OTTHUMG00000031072
Pharos: O15211(Tbio)
UniProt: O15211 A0A024RCS9
LinkDB All DBs
Position
6p21.32
AA seq 777 aa AA seqDB search
MLPRPLRLLLDTSPPGGVVLSSFRSRDPEEGGGPGGLVVGGGQEEEEEEEEEAPVSVWDE
EEDGAVFTVTSRQYRPLDPLVPMPPPRSSRRLRAGTLEALVRHLLDTRTSGTDVSFMSAF
LATHRAFTSTPALLGLMADRLEALESHPTDELERTTEVAISVLSTWLASHPEDFGSEAKG
QLDRLESFLLQTGYAAGKGVGGGSADLIRNLRSRVDPQAPDLPKPLALPGDPPADPTDVL
VFLADHLAEQLTLLDAELFLNLIPSQCLGGLWGHRDRPGHSHLCPSVRATVTQFNKVAGA
VVSSVLGATSTGEGPGEVTIRPLRPPQRARLLEKWIRVAEECRLLRNFSSVYAVVSALQS
SPIHRLRAAWGEATRDSLRVFSSLCQIFSEEDNYSQSRELLVQEVKLQSPLEPHSKKAPR
SGSRGGGVVPYLGTFLKDLVMLDAASKDELENGYINFDKRRKEFAVLSELRRLQNECRGY
NLQPDHDIQRWLQGLRPLTEAQSHRVSCEVEPPGSSDPPAPRVLRPTLVISQWTEVLGSV
GVPTPLVSCDRPSTGGDEAPTTPAPLLTRLAQHMKWPSVSSLDSALESSPSLHSPADPSH
LSPPASSPRPSRGHRRSASCGSPLSGGAEEASGGTGYGGEGSGPGASDCRIIRVQMELGE
DGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELVQLLPGERELTIPASANVFYA
MDGASHDFLLRQRRRSSTATPGVTSGPSASGTPPSEGGGGSFPRIKATGRKIARALF
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgctcccgcggcccctgcggctgcttttggacacgagcccccccgggggagtcgtactg
agcagcttccgaagccgggaccccgaagagggtgggggcccaggtggcctggtcgtgggc
ggggggcaggaggaagaggaggaggaagaagaagaggcccctgtgtccgtctgggatgag
gaggaggatggtgccgtgtttaccgtcacaagccgccaatatcgacctcttgatcccttg
gtccctatgcctcccccacgttcctcccgacggctccgagctggcactctggaggccctg
gtcagacacctactggatacccggacatcagggactgatgtgagcttcatgtcagccttc
ctggctacccaccgggccttcacctccacgcctgccttgctagggcttatggctgacagg
ctggaagcccttgaatctcatcctaccgacgaactagagaggacaacagaggtagccatc
tctgtactgtcaacctggctggcctctcaccctgaggattttggctctgaggccaagggt
cagcttgaccggcttgagagcttcttacttcagacagggtatgcagcagggaagggtgtt
ggggggggcagcgctgacctcatccgcaatctccggtcccgggtggacccccaggccccc
gaccttcctaagcccctggccctccccggcgatccccctgctgaccccacggatgtcctg
gtgttcctcgctgaccacttggccgaacagctgaccctgctagatgcggaactttttctc
aatttgatcccctctcagtgcctgggaggcctgtggggtcacagagaccggccaggacat
tctcacctctgcccatctgtccgagctactgtcacacagtttaacaaggtggcaggggca
gtggttagttctgtcctgggggctacttccactggagagggacctggggaggtgaccata
cggccactccgtcccccacagagggcccggctcctggagaagtggatccgcgtggcagag
gagtgccggctgctccgaaacttctcttcagtttatgccgtggtgtcagccctgcagtcc
agccccatccacaggcttcgggcagcctggggggaagcaaccagggacagcctcagagtc
ttttccagcctctgccagattttctccgaggaggataattattcccagagtcgggagctg
ctcgtgcaggaggtgaagctgcagtctcctctggagccacactccaagaaggccccgagg
tctggctcccggggtgggggtgtggtcccataccttggcaccttcctgaaggaccttgtg
atgctggatgcagcctccaaggatgagttggagaatggatacatcaattttgacaagcgg
aggaaggagtttgcagtcctttctgagttgcgacggctccagaatgaatgtcgtggctat
aacctccaacctgaccatgatatccagaggtggctacaggggctccggccactgacagag
gctcagagccatcgtgtatcctgtgaggtggagccacctggttccagtgaccctcctgcc
ccacgggtgcttcggccaacattggtcatctcgcagtggacagaggttttgggctctgtt
ggggtccctaccccgcttgtgtcctgtgaccggcccagtactgggggagatgaggcgcct
acaactcctgctcctctgctgactcggctggcccagcacatgaagtggccatctgtctcg
tcactagactctgccttggaaagcagtccatccctgcacagtccagctgaccccagccac
ctctccccaccagcctcctcccctaggccttctcgaggtcaccgccgctcagcctcctgt
ggctccccgctgagtgggggtgcagaagaggcctccggggggactggatatgggggagag
ggatctgggccaggggcctctgattgccgtatcatccgagtccagatggagttgggggaa
gatggcagtgtctataagagcattttggtgacaagccaggacaaggctccaagtgtcatc
agtcgtgtccttaagaaaaacaatcgtgactctgcagtggcttcagagtatgagctggta
cagctgctaccaggggagcgagagctgactatcccagcctcggctaatgtattctacgcc
atggatggagcttcacacgatttcctcctgcggcagcggcgaaggtcctctactgctaca
cctggcgtcaccagtggcccgtctgcctcaggaactcctccgagtgagggaggagggggc
tcctttcccaggatcaaggccacagggaggaagattgcacgggcactgttctga

DBGET integrated database retrieval system