KEGG   Homo sapiens (human): 5867Help
Entry
5867              CDS       T01001                                 

Gene name
RAB4A, HRES-1, HRES-1/RAB4, HRES1, RAB4
Definition
(RefSeq) RAB4A, member RAS oncogene family
  KO
K07879  Ras-related protein Rab-4A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5867 (RAB4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5867 (RAB4A)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    5867 (RAB4A)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    5867 (RAB4A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    5867 (RAB4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA SRPRB AAA_7 PduV-EutP AAA_22 AAA_16 Septin ATPase_2 ATPase DUF2075 NACHT
Motif
Other DBs
NCBI-GeneID: 5867
NCBI-ProteinID: NP_004569
OMIM: 179511
HGNC: 9781
Ensembl: ENSG00000168118
Vega: OTTHUMG00000037627
Pharos: P20338(Tbio)
UniProt: P20338 A0A024R3U9
LinkDB All DBs
Structure
PDB: 

Position
1q42.13
AA seq 218 aa AA seqDB search
MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGK
YVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIV
IILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIES
GELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagacggccatgtccgaaacctacgattttttgtttaagttcttggttattgga
aatgcaggaactggcaaatcttgcttacttcatcagtttattgaaaaaaaattcaaagat
gactcaaatcatacaataggagtggaatttggttcaaagataataaatgttggtggtaaa
tatgtaaagttacaaatatgggatacagcaggacaagaacgattcaggtccgtgacgaga
agttattaccgaggcgcggccggggctctcctcgtctatgatatcaccagccgagaaacc
tacaatgcgcttactaattggttaacagatgcccgaatgctagcgagccagaacattgtg
atcatcctttgtggaaacaagaaggacctggatgcagatcgtgaagttaccttcttagaa
gcctccagatttgctcaagaaaatgagctgatgtttttggaaacaagtgcgctcacaggg
gagaatgtagaagaggcttttgtacagtgtgcaagaaaaatacttaacaaaatcgaatca
ggtgagctggacccagaaagaatgggctcaggtattcagtacggagatgctgccttgaga
cagctgaggtcaccgcggcgcgcacaggccccgaacgctcaggagtgtggttgttag

DBGET integrated database retrieval system