KEGG   Homo sapiens (human): 5886
Entry
5886              CDS       T01001                                 

Gene name
RAD23A, HHR23A, HR23A
Definition
(RefSeq) RAD23 homolog A, nucleotide excision repair protein
  KO
K10839  UV excision repair protein RAD23
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5886 (RAD23A)
  09124 Replication and repair
   03420 Nucleotide excision repair
    5886 (RAD23A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5886 (RAD23A)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5886 (RAD23A)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    5886 (RAD23A)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      5886 (RAD23A)
SSDB
Motif
Pfam: UBA XPC-binding ubiquitin Rad60-SLD UBA_3 Rad60-SLD_2 Ubiquitin_2
Other DBs
NCBI-GeneID: 5886
NCBI-ProteinID: NP_005044
OMIM: 600061
HGNC: 9812
Ensembl: ENSG00000179262
Vega: OTTHUMG00000180723
Pharos: P54725(Tbio)
UniProt: P54725 A0A024R7G8
LinkDB
Structure
PDB: 

Position
19p13.13
AA seq 363 aa
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVP
IRDYRIDEKNFVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAARE
DKSPSEESAPTTSPESVSGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERV
VAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQ
FQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGE
VGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNF
DDE
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggccgtcaccatcacgctcaaaacgctgcagcagcagaccttcaagatccgcatggag
cctgacgagacggtgaaggtgctaaaggagaagatagaagctgagaagggtcgtgatgcc
ttccccgtggctggacagaaactcatctatgccggcaagatcttgagtgacgatgtccct
atcagggactatcgcatcgatgagaagaactttgtggtcgtcatggtgaccaagaccaaa
gccggccagggtacctcagcacccccagaggcctcacccacagctgccccagagtcctct
acatccttcccgcctgcccccacctcaggcatgtcccatcccccacctgccgccagagag
gacaagagcccatcagaggaatccgcccccacgacgtccccagagtctgtgtcaggctct
gttccctcttcaggtagcagcgggcgagaggaagacgcggcctccacgctagtgacgggc
tctgagtatgagacgatgctgacggagatcatgtccatgggctatgagcgagagcgggtc
gtggccgccctgagagccagctacaacaacccccaccgagccgtggagtatctgctcacg
ggaattcctgggagccccgagccggaacacggttctgtccaggagagccaggtatcggag
cagccggccacggaagcagcaggagagaaccccctggagttcctgcgggaccagccccag
ttccagaacatgcggcaggtgattcagcagaaccctgcgctgctgcccgccctgctccag
cagctgggccaggagaaccctcagcttttacagcaaatcagccggcaccaggagcagttc
atccagatgctgaacgagccccctggggagctggcggacatctcagatgtggagggggag
gtgggcgccataggagaggaggccccgcagatgaactacatccaggtgacgccgcaggag
aaagaagctatagagaggttgaaggccctgggcttcccagagagcctggtcatccaggcc
tatttcgcgtgtgaaaaaaatgagaacttggctgccaacttcctcctgagtcagaacttt
gatgacgagtga

KEGG   Homo sapiens (human): 5887
Entry
5887              CDS       T01001                                 

Gene name
RAD23B, HHR23B, HR23B, P58
Definition
(RefSeq) RAD23 homolog B, nucleotide excision repair protein
  KO
K10839  UV excision repair protein RAD23
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5887 (RAD23B)
  09124 Replication and repair
   03420 Nucleotide excision repair
    5887 (RAD23B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5887 (RAD23B)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5887 (RAD23B)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    5887 (RAD23B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      5887 (RAD23B)
SSDB
Motif
Pfam: UBA XPC-binding ubiquitin Rad60-SLD Rad60-SLD_2 UBA_3 DUF2407 UBA_2 Ubiquitin_2 DUF1421
Other DBs
NCBI-GeneID: 5887
NCBI-ProteinID: NP_002865
OMIM: 600062
HGNC: 9813
Ensembl: ENSG00000119318
Vega: OTTHUMG00000020446
Pharos: P54727(Tbio)
UniProt: P54727
LinkDB
Structure
PDB: 
1PVE 1UEL 1P1A

Position
9q31.2
AA seq 409 aa
MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALK
EYKIDEKNFVVVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPT
STPASITPASATASSEPAPASAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDA
TSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVD
PPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP
ALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYI
QVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgcaggtcaccctgaagaccctccagcagcagaccttcaagatagacattgaccccgag
gagacggtgaaagcactgaaagagaagattgaatctgaaaaggggaaagatgcctttcca
gtagcaggtcaaaaattaatttatgcaggcaaaatcctcaatgatgatactgctctcaaa
gaatataaaattgatgagaaaaactttgtggtggttatggtgaccaaacccaaagcagtg
tccacaccagcaccagctacaactcagcagtcagctcctgccagcactacagcagttact
tcctccaccaccacaactgtggctcaggctccaacccctgtccctgccttggcccccact
tccacacctgcatccatcactccagcatcagcgacagcatcttctgaacctgcacctgct
agtgcagctaaacaagagaagcctgcagaaaagccagcagagacaccagtggctactagc
ccaacagcaactgacagtacatcgggtgattcttctcggtcaaacctttttgaagatgca
acgagtgcacttgtgacgggtcagtcttacgagaatatggtaactgagatcatgtcaatg
ggctatgaacgagagcaagtaattgcagccctgagagccagtttcaacaaccctgacaga
gcagtggagtatcttttaatgggaatccctggagatagagaaagtcaggctgtggttgac
ccccctcaagcagctagtactggggctcctcagtcttcagcagtggctgcagctgcagca
actacgacagcaacaactacaacaacaagttctggaggacatccccttgaatttttacgg
aatcagcctcagtttcaacagatgagacaaattattcagcagaatccttccttgcttcca
gcgttactacagcagataggtcgagagaatcctcaattacttcagcaaattagccaacac
caggagcattttattcagatgttaaatgaaccagttcaagaagctggtggtcaaggagga
ggaggtggaggtggcagtggaggaattgcagaagctggaagtggtcatatgaactacatt
caagtaacacctcaggaaaaagaagctatagaaaggttaaaggcattaggatttcctgaa
ggacttgtgatacaagcgtattttgcttgtgagaagaatgagaatttggctgccaatttt
cttctacagcagaactttgatgaagattga

DBGET integrated database retrieval system