KEGG   Homo sapiens (human): 5888Help
Entry
5888              CDS       T01001                                 

Gene name
RAD51, BRCC5, FANCR, HRAD51, HsRad51, HsT16930, MRMV2, RAD51A, RECA
Definition
(RefSeq) RAD51 recombinase
  KO
K04482  DNA repair protein RAD51
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
hsa03460  Fanconi anemia pathway
hsa05200  Pathways in cancer
hsa05212  Pancreatic cancer
Disease
H00238  Fanconi anemia
H01287  Congenital mirror movements (CMM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    5888 (RAD51)
   03460 Fanconi anemia pathway
    5888 (RAD51)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5888 (RAD51)
   05212 Pancreatic cancer
    5888 (RAD51)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Others
    5888 (RAD51)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    5888 (RAD51)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     5888 (RAD51)
    RecA family proteins
     5888 (RAD51)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     5888 (RAD51)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad51 AAA_25 RecA HHH_5 ATPase HhH-GPD HHH
Motif
Other DBs
NCBI-GeneID: 5888
NCBI-ProteinID: NP_002866
OMIM: 179617
HGNC: 9817
Ensembl: ENSG00000051180 ENSG00000285396
Vega: OTTHUMG00000130067
Pharos: Q06609(Tchem)
UniProt: Q06609
LinkDB All DBs
Structure
PDB: 

Position
15q15.1
AA seq 339 aa AA seqDB search
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgcagatgcagcttgaagcaaatgcagatacttcagtggaagaagaaagcttt
ggcccacaacccatttcacggttagagcagtgtggcataaatgccaacgatgtgaagaaa
ttggaagaagctggattccatactgtggaggctgttgcctatgcgccaaagaaggagcta
ataaatattaagggaattagtgaagccaaagctgataaaattctggctgaggcagctaaa
ttagttccaatgggtttcaccactgcaactgaattccaccaaaggcggtcagagatcata
cagattactactggctccaaagagcttgacaaactacttcaaggtggaattgagactgga
tctatcacagaaatgtttggagaattccgaactgggaagacccagatctgtcatacgcta
gctgtcacctgccagcttcccattgaccggggtggaggtgaaggaaaggccatgtacatt
gacactgagggtacctttaggccagaacggctgctggcagtggctgagaggtatggtctc
tctggcagtgatgtcctggataatgtagcatatgctcgagcgttcaacacagaccaccag
acccagctcctttatcaagcatcagccatgatggtagaatctaggtatgcactgcttatt
gtagacagtgccaccgccctttacagaacagactactcgggtcgaggtgagctttcagcc
aggcagatgcacttggccaggtttctgcggatgcttctgcgactcgctgatgagtttggt
gtagcagtggtaatcactaatcaggtggtagctcaagtggatggagcagcgatgtttgct
gctgatcccaaaaaacctattggaggaaatatcatcgcccatgcatcaacaaccagattg
tatctgaggaaaggaagaggggaaaccagaatctgcaaaatctacgactctccctgtctt
cctgaagctgaagctatgttcgccattaatgcagatggagtgggagatgccaaagactga

DBGET integrated database retrieval system