KEGG   Homo sapiens (human): 5897
Entry
5897              CDS       T01001                                 

Gene name
RAG2, RAG-2
Definition
(RefSeq) recombination activating 2
  KO
K10988  recombination-activating protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa05340  Primary immunodeficiency
Disease
H00092  T-B-Severe combined immunodeficiency
H00093  Combined immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    5897 (RAG2)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    5897 (RAG2)
SSDB
Motif
Pfam: RAG2 RAG2_PHD Kelch_5 Kelch_3 PHD CHU_C
Other DBs
NCBI-GeneID: 5897
NCBI-ProteinID: NP_000527
OMIM: 179616
HGNC: 9832
Ensembl: ENSG00000175097
Vega: OTTHUMG00000166393
Pharos: P55895(Tbio)
UniProt: P55895
LinkDB
Position
11p12
AA seq 527 aa
MSLQMVTVSNNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHLDVKHNHVKLKPT
IFSKDSCYLPPLRYPATCTFKGSLESEKHQYIIHGGKTPNNEVSDKIYVMSIVCKNNKKV
TFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGVLFGGRSYMPSTHRTTEKWNSVADCLP
CVFLVDFEFGCATSYILPELQDGLSFHVSIAKNDTIYILGGHSLANNIRPANLYRIRVDL
PLGSPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLENQKRMICNIISLEDNKIEIR
EMETPDWTPDIKHSKIWFGSNMGNGTVFLGIPGDNKQVVSEGFYFYMLKCAEDDTNEEQT
TFTNSQTSTEDPGDSTPFEDSEEFCFSAEANSFDGDDEFDTYNEDDEEDESETGYWITCC
PTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNE
HVEIARALHTPQRVLPLKKPPMKSLRKKGSGKILTPAKKSFLRRLFD
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgtctctgcagatggtaacagtcagtaataacatagccttaattcagccaggcttctca
ctgatgaattttgatggacaagttttcttctttggacaaaaaggctggcccaaaagatcc
tgccccactggagttttccatctggatgtaaagcataaccatgtcaaactgaagcctaca
attttctctaaggattcctgctacctccctcctcttcgctacccagccacttgcacattc
aaaggcagcttggagtctgaaaagcatcaatacatcatccatggagggaaaacaccaaac
aatgaggtttcagataagatttatgtcatgtctattgtttgcaagaacaacaaaaaggtt
acttttcgctgcacagagaaagacttggtaggagatgttcctgaagccagatatggtcat
tccattaatgtggtgtacagccgagggaaaagtatgggtgttctctttggaggacgctca
tacatgccttctacccacagaaccacagaaaaatggaatagtgtagctgactgcctgccc
tgtgttttcctggtggattttgaatttgggtgtgctacatcatacattcttccagaactt
caggatgggctatcttttcatgtctctattgccaaaaatgacaccatctatattttagga
ggacattcacttgccaataatatccggcctgccaacctgtacagaataagggttgatctt
cccctgggtagcccagctgtgaattgcacagtcttgccaggaggaatctctgtctccagt
gcaatcctgactcaaactaacaatgatgaatttgttattgttggtggctatcagcttgaa
aatcaaaaaagaatgatctgcaacatcatctctttagaggacaacaagatagaaattcgt
gagatggagaccccagattggaccccagacattaagcacagcaagatatggtttggaagc
aacatgggaaatggaactgtttttcttggcataccaggagacaataaacaagttgtttca
gaaggattctatttctatatgttgaaatgtgctgaagatgatactaatgaagagcagaca
acattcacaaacagtcaaacatcaacagaagatccaggggattccactccctttgaagac
tctgaagaattttgtttcagtgcagaagcaaatagttttgatggtgatgatgaatttgac
acctataatgaagatgatgaagaagatgagtctgagacaggctactggattacatgctgc
cctacttgtgatgtggatatcaacacttgggtaccattctattcaactgagctcaacaaa
cccgccatgatctactgctctcatggggatgggcactgggtccatgctcagtgcatggat
ctggcagaacgcacactcatccatctgtcagcaggaagcaacaagtattactgcaatgag
catgtggagatagcaagagctctacacactccccaaagagtcctacccttaaaaaagcct
ccaatgaaatccctccgtaaaaaaggttctggaaaaatcttgactcctgccaagaaatcc
tttcttagaaggttgtttgattag

DBGET integrated database retrieval system