KEGG   Homo sapiens (human): 58985Help
Entry
58985             CDS       T01001                                 

Gene name
IL22RA1, CRF2-9, IL22R, IL22R1
Definition
(RefSeq) interleukin 22 receptor subunit alpha 1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    58985 (IL22RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    58985 (IL22RA1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    58985 (IL22RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    58985 (IL22RA1)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL10/28 receptor family
   58985 (IL22RA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tissue_fac Interfer-bind
Motif
Other DBs
NCBI-GeneID: 58985
NCBI-ProteinID: NP_067081
OMIM: 605457
HGNC: 13700
Ensembl: ENSG00000142677
Vega: OTTHUMG00000003041
Pharos: Q8N6P7(Tbio)
UniProt: Q8N6P7
LinkDB All DBs
Structure
PDB: 

Position
1p36.11
AA seq 574 aa AA seqDB search
MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTY
GERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTT
LKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLG
GKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMG
FLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ
YSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVG
PPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLS
SPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNV
LHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPK
DEAKSPAPETSDLEQPTELDSLFRGLALTVQWES
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaggacgctgctgaccatcttgactgtgggatccctggctgctcacgcccctgaggac
ccctcggatctgctccagcacgtgaaattccagtccagcaactttgaaaacatcctgacg
tgggacagcgggccggagggcaccccagacacggtctacagcatcgagtataagacgtac
ggagagagggactgggtggcaaagaagggctgtcagcggatcacccggaagtcctgcaac
ctgacggtggagacgggcaacctcacggagctctactatgccagggtcaccgctgtcagt
gcgggaggccggtcagccaccaagatgactgacaggttcagctctctgcagcacactacc
ctcaagccacctgatgtgacctgtatctccaaagtgagatcgattcagatgattgttcat
cctacccccacgccaatccgtgcaggcgatggccaccggctaaccctggaagacatcttc
catgacctgttctaccacttagagctccaggtcaaccgcacctaccaaatgcaccttgga
gggaagcagagagaatatgagttcttcggcctgacccctgacacagagttccttggcacc
atcatgatttgcgttcccacctgggccaaggagagtgccccctacatgtgccgagtgaag
acactgccagaccggacatggacctactccttctccggagccttcctgttctccatgggc
ttcctcgtcgcagtactctgctacctgagctacagatatgtcaccaagccgcctgcacct
cccaactccctgaacgtccagcgagtcctgactttccagccgctgcgcttcatccaggag
cacgtcctgatccctgtctttgacctcagcggccccagcagtctggcccagcctgtccag
tactcccagatcagggtgtctggacccagggagcccgcaggagctccacagcggcatagc
ctgtccgagatcacctacttagggcagccagacatctccatcctccagccctccaacgtg
ccacctccccagatcctctccccactgtcctatgccccaaacgctgcccctgaggtcggg
cccccatcctatgcacctcaggtgacccccgaagctcaattcccattctacgccccacag
gccatctctaaggtccagccttcctcctatgcccctcaagccactccggacagctggcct
ccctcctatggggtatgcatggaaggttctggcaaagactcccccactgggacactttct
agtcctaaacaccttaggcctaaaggtcagcttcagaaagagccaccagctggaagctgc
atgttaggtggcctttctctgcaggaggtgacctccttggctatggaggaatcccaagaa
gcaaaatcattgcaccagcccctggggatttgcacagacagaacatctgacccaaatgtg
ctacacagtggggaggaagggacaccacagtacctaaagggccagctccccctcctctcc
tcagtccagatcgagggccaccccatgtccctccctttgcaacctccttcccgtccatgt
tccccctcggaccaaggtccaagtccctggggcctgctggagtcccttgtgtgtcccaag
gatgaagccaagagcccagcccctgagacctcagacctggagcagcccacagaactggat
tctcttttcagaggcctggccctgactgtgcagtgggagtcctga

DBGET integrated database retrieval system