KEGG   Homo sapiens (human): 59
Entry
59                CDS       T01001                                 

Gene name
ACTA2, ACTSA
Definition
(RefSeq) actin alpha 2, smooth muscle
  KO
K12313  actin, aortic smooth muscle
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04926  Relaxin signaling pathway
Disease
H00801  Familial thoracic aortic aneurysm and dissection
H01396  Moyamoya disease
H01630  Patent ductus arteriosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    59 (ACTA2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    59 (ACTA2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    59 (ACTA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    59 (ACTA2)
   04147 Exosome [BR:hsa04147]
    59 (ACTA2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     59 (ACTA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   59 (ACTA2)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 59
NCBI-ProteinID: NP_001135417
OMIM: 102620
HGNC: 130
Ensembl: ENSG00000107796
Vega: OTTHUMG00000018700
Pharos: P62736(Tbio)
UniProt: P62736 D2JYH4
LinkDB
Position
10q23.31
AA seq 377 aa
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtgtgaagaagaggacagcactgccttggtgtgtgacaatggctctgggctctgtaag
gccggctttgctggggacgatgctcccagggctgttttcccatccattgtgggacgtccc
agacatcagggggtgatggtgggaatgggacaaaaagacagctacgtgggtgacgaagca
cagagcaaaagaggaatcctgaccctgaagtacccgatagaacatggcatcatcaccaac
tgggacgacatggaaaagatctggcaccactctttctacaatgagcttcgtgttgcccct
gaagagcatcccaccctgctcacggaggcacccctgaaccccaaggccaaccgggagaaa
atgactcaaattatgtttgagactttcaatgtcccagccatgtatgtggctatccaggcg
gtgctgtctctctatgcctctggacgcacaactggcatcgtgctggactctggagatggt
gtcacccacaatgtccccatctatgagggctatgccttgccccatgccatcatgcgtctg
gatctggctggccgagatctcactgactacctcatgaagatcctgactgagcgtggctat
tccttcgttactactgctgagcgtgagattgtccgggacatcaaggagaaactgtgttat
gtagctctggactttgaaaatgagatggccactgccgcatcctcatcctcccttgagaag
agttacgagttgcctgatgggcaagtgatcaccatcggaaatgaacgtttccgctgccca
gagaccctgttccagccatccttcatcgggatggagtctgctggcatccatgaaaccacc
tacaacagcatcatgaagtgtgatattgacatcaggaaggacctctatgctaacaatgtc
ctatcagggggcaccactatgtaccctggcattgccgaccgaatgcagaaggagatcacg
gccctagcacccagcaccatgaagatcaagatcattgcccctccggagcgcaaatactct
gtctggatcggtggctccatcctggcctctctgtccaccttccagcagatgtggatcagc
aaacaggaatacgatgaagccgggccttccattgtccaccgcaaatgcttctaa

KEGG   Homo sapiens (human): 72
Entry
72                CDS       T01001                                 

Gene name
ACTG2, ACT, ACTA3, ACTE, ACTL3, ACTSG, VSCM
Definition
(RefSeq) actin gamma 2, smooth muscle
  KO
K12315  actin, gamma-enteric smooth muscle
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
Disease
H01869  Megacystis microcolon intestinal hypoperistalsis syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    72 (ACTG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    72 (ACTG2)
   04147 Exosome [BR:hsa04147]
    72 (ACTG2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     72 (ACTG2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   72 (ACTG2)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 72
NCBI-ProteinID: NP_001606
OMIM: 102545
HGNC: 145
Ensembl: ENSG00000163017
Vega: OTTHUMG00000129813
Pharos: P63267(Tbio)
UniProt: P63267
LinkDB
Position
2p13.1
AA seq 376 aa
MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM
TQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLD
LAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKS
YELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVL
SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
PEYDEAGPSIVHRKCF
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgtgtgaagaggagaccaccgcgctcgtgtgtgacaatggctctggcctgtgcaaggca
ggcttcgcaggagatgatgccccccgggctgtcttcccctccattgtgggccgccctcgc
caccagggtgtgatggtgggaatgggccagaaagacagctatgtgggggatgaggctcag
agcaagcgagggatcctaactctcaaataccccattgaacacggcatcatcaccaactgg
gatgacatggagaagatctggcaccactccttctacaatgagctgcgtgtagcacctgaa
gagcaccccaccctgctcacagaggctcccctaaatcccaaggccaacagggaaaagatg
acccagatcatgtttgaaaccttcaatgtccctgccatgtacgtcgccattcaagctgtg
ctctccctctatgcctctggccgcacgacaggcatcgtcctggattcaggtgatggcgtc
acccacaatgtccccatctatgaaggctatgccctgccccatgccatcatgcgcctggac
ttggctggccgtgacctcacggactacctcatgaagatcctcacagagagaggctattcc
tttgtgaccacagctgagagagaaattgtgcgagacatcaaggagaagctgtgctatgtg
gccctggattttgagaatgagatggccacagcagcttcctcttcctccctggagaagagc
tatgagctgccagatgggcaggttatcaccattggcaatgagcgcttccgctgccctgag
accctcttccagccttcctttattggcatggagtccgctggaattcatgagacaacctac
aattccatcatgaagtgtgacattgacatccgtaaggacttatatgccaacaatgtcctc
tctgggggcaccaccatgtaccctggcattgctgacaggatgcagaaggagatcacagcc
ctggcccccagcaccatgaagatcaagattattgctcccccagagcggaagtactcagtc
tggatcgggggctctatcctggcctctctctccaccttccagcagatgtggatcagcaag
cctgagtatgatgaggcagggccctccattgtccacaggaagtgcttctaa

DBGET integrated database retrieval system