KEGG   Homo sapiens (human): 5902
Entry
5902              CDS       T01001                                 

Gene name
RANBP1, HTF9A
Definition
(RefSeq) RAN binding protein 1
  KO
K15306  Ran-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    5902 (RANBP1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5902 (RANBP1)
SSDB
Motif
Pfam: Ran_BP1 DUF1681
Other DBs
NCBI-GeneID: 5902
NCBI-ProteinID: NP_002873
OMIM: 601180
HGNC: 9847
Ensembl: ENSG00000099901
Vega: OTTHUMG00000150490
Pharos: P43487(Tbio)
UniProt: P43487 A0A140VK94
LinkDB
Structure
PDB: 
1K5D 1K5G

Position
22q11.21
AA seq 201 aa
MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFAS
ENDLPEWKERGTGDVKLLKHKEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW
VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKV
AEKLEALSVKEETKEDAEEKQ
NT seq 606 nt   +upstreamnt  +downstreamnt
atggcggccgccaaggacactcatgaggaccatgatacttccactgagaatacagacgag
tccaaccatgaccctcagtttgagccaatagtttctcttcctgagcaagaaattaaaaca
ctggaagaagatgaagaggaactttttaaaatgcgggcaaaactgttccgatttgcctct
gagaacgatctcccagaatggaaggagcgaggcactggtgacgtcaagctcctgaagcac
aaggagaaaggggccatccgcctcctcatgcggagggacaagaccctgaagatctgtgcc
aaccactacatcacgccgatgatggagctgaagcccaacgcaggtagcgaccgtgcctgg
gtctggaacacccacgctgacttcgccgacgagtgccccaagccagagctgctggccatc
cgcttcctgaatgctgagaatgcacagaaattcaaaacaaagtttgaagaatgcaggaaa
gagatcgaagagagagaaaagaaagcaggatcaggcaaaaatgatcatgccgaaaaagtg
gcggaaaagctagaagctctctcggtgaaggaggagaccaaggaggatgctgaggagaag
caataa

DBGET integrated database retrieval system