KEGG   Homo sapiens (human): 5909Help
Entry
5909              CDS       T01001                                 

Gene name
RAP1GAP, RAP1GA1, RAP1GAP1, RAP1GAPII, RAPGAP
Definition
(RefSeq) RAP1 GTPase activating protein
  KO
K17700  RAP1 GTPase activating protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5909 (RAP1GAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rap_GAP GoLoco
Motif
Other DBs
NCBI-GeneID: 5909
NCBI-ProteinID: NP_002876
OMIM: 600278
HGNC: 9858
Ensembl: ENSG00000076864
Vega: OTTHUMG00000007513
Pharos: P47736(Tbio)
UniProt: P47736 A0A024RAB5
LinkDB All DBs
Structure
PDB: 

Position
1p36.12
AA seq 663 aa AA seqDB search
MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPLILLPQFGGYWIEGTN
HEITSIPETEPLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYSLDAALGHLVFSLKYDV
IGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRL
IVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVEFLEFLGQKVKLQDFKGFR
GGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQLQRKRHIGNDIVAVVFQDE
NTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARDDVPFFGPPLPDPAVFRKGPE
FQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGGDEDKMEN
GSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTSHSGSFAPNNPDLAKAAGISLIV
PGKSPTRKKSGPFGSRRSSAIGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQ
SSPEMPTTKNRAETAAQRAEALKDFSRSSSSASSFASVVEETEGVDGEDTGLESVSSSGT
PHKRDSFIYSTWLEDSVSTTSGGSSPGPSRSPHPDAGKLGDPACPEIKIQLEASEQHMPQ
LGC
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgattgagaagatgcagggaagcaggatggatgaacaacgctgctccttcccgccgccc
ctcaaaacagaggaggactacattccatacccgagcgtgcacgaggtcttggggcgagaa
ggacccttccccctcatcctgctgccccagtttgggggctactggattgagggcaccaac
cacgaaatcaccagcatccccgagacagagccactgcagtcgcccacaaccaaggtgaag
ctcgagtgcaaccccacagcccgcatctaccggaagcactttctcggcaaggagcatttc
aattactactcactggacgctgccctcggccaccttgtcttctcactcaagtacgatgtc
atcggggaccaagagcacctgcggctgctgctcaggaccaagtgccggacataccatgat
gtcatccccatctcctgcctcaccgagttccctaatgttgtccagatggcaaagttggtg
tgtgaagacgtcaatgtggatcggttctatcctgtgctctaccccaaggcttcccggctc
atcgtcacctttgacgagcatgtcatcagcaataacttcaagtttggcgtcatttatcag
aagcttgggcagacctccgaggaagaactcttcagcaccaatgaggaaagtcccgctttc
gtggagttccttgaatttcttggccagaaggtcaaactgcaggactttaaggggttccga
ggaggcctggacgtgacccacgggcagacggggaccgaatctgtgtactgcaacttccgc
aacaaggagatcatgtttcacgtgtccaccaagctgccatacacggaaggggacgcccag
cagttgcagcggaagcggcacatcgggaacgacatcgtggctgtggtcttccaggatgag
aacactcctttcgtgcccgacatgatcgcgtccaacttcctgcatgcctacgtcgtggtg
caggctgagggcgggggccctgatggccccctctacaaggtctctgtcactgcaagagat
gatgtgcccttctttggaccccccctcccggaccccgctgtgttcaggaaggggcctgag
ttccaggaatttttgctgacaaagctgatcaatgctgaatatgcctgctacaaggcagag
aagtttgccaaactggaggagcggacgcgggccgccctcctggagacgctctatgaggaa
ctacacatccacagccagtccatgatgggcttgggcggcgacgaggacaagatggagaat
ggcagtgggggcggcggcttctttgagtctttcaagcgggtcatccggagccgcagccag
tccatggatgccatggggctgagcaacaagaagcccaacaccgtgtccaccagccacagc
gggagcttcgcgcccaacaaccccgacctggccaaggcggctggaatatcactgattgtc
cctgggaagagccccacgaggaagaagtcgggcccgttcggctcccgccgcagcagcgcc
attggcatcgagaacatacaggaggtgcaggagaagagggagagccctccggctggtcag
aagaccccagacagcgggcacgtctcacaggagcccaagtcggagaactcatccactcag
agctccccagagatgcccacgaccaagaacagagcggagaccgcagcgcagagagcagag
gcgctcaaggacttctcccgctcctcgtccagtgccagcagcttcgccagcgtggtggag
gagacggagggtgtggacggagaggacacaggcctggagagcgtgtcatcctcaggaaca
ccccacaagcgggactccttcatctatagcacgtggctggaggacagtgtcagcaccact
agtgggggcagctccccaggcccctctcgatcaccccacccagacgccggcaagttgggg
gaccctgcgtgtcccgagatcaagatccagctggaagcatctgagcagcacatgccccag
ctgggctgttag

DBGET integrated database retrieval system