KEGG   Homo sapiens (human): 5922
Entry
5922              CDS       T01001                                 

Gene name
RASA2, GAP1M
Definition
(RefSeq) RAS p21 protein activator 2
  KO
K08053  Ras GTPase-activating protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5922 (RASA2)
   04014 Ras signaling pathway
    5922 (RASA2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    5922 (RASA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    5922 (RASA2)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   5922 (RASA2)
SSDB
Motif
Pfam: C2 RasGAP PH BTK PH_8 PH_3
Other DBs
NCBI-GeneID: 5922
NCBI-ProteinID: NP_001290174
OMIM: 601589
HGNC: 9872
Ensembl: ENSG00000155903
Vega: OTTHUMG00000160221
Pharos: Q15283(Tdark)
UniProt: Q15283
LinkDB
Position
3q23
AA seq 850 aa
MAAAAPAAAAASSEAPAASATAEPEAGDQDSREVRVLQSLRGKICEAKNLLPYLGPHKMR
DCFCTINLDQEEVYRTQVVEKSLSPFFSEEFYFEIPRTFQYLSFYVYDKNVLQRDLRIGK
VAIKKEDLCNHSGKETWFSLQPVDSNSEVQGKVHLELKLNELITENGTVCQQLVVHIKAC
HGLPLINGQSCDPYATVSLVGPSRNDQKKTKVKKKTSNPQFNEIFYFEVTRSSSYTRKSQ
FQVEEEDIEKLEIRIDLWNNGNLVQDVFLGEIKVPVNVLRTDSSHQAWYLLQPRDNGNKS
SKTDDLGSLRLNICYTEDYVLPSEYYGPLKTLLLKSPDVQPISASAAYILSEICRDKNDA
VLPLVRLLLHHDKLVPFATAVAELDLKDTQDANTIFRGNSLATRCLDEMMKIVGGHYLKV
TLKPILDEICDSSKSCEIDPIKLKEGDNVENNKENLRYYVDKLFNTIVKSSMSCPTVMCD
IFYSLRQMATQRFPNDPHVQYSAVSSFVFLRFFAVAVVSPHTFHLRPHHPDAQTIRTLTL
ISKTIQTLGSWGSLSKSKSSFKETFMCEFFKMFQEEGYIIAVKKFLDEISSTETKESSGT
SEPVHLKEGEMYKRAQGRTRIGKKNFKKRWFCLTSRELTYHKQPGSKDAIYTIPVKNILA
VEKLEESSFNKKNMFQVIHTEKPLYVQANNCVEANEWIDVLCRVSRCNQNRLSFYHPSVY
LNGNWLCCQETGENTLGCKPCTAGVPADIQIDIDEDRETERIYSLFTLSLLKLQKMEEAC
GTIAVYQGPQKEPDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGS
KENPIVGKAS
NT seq 2553 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgcctgctgctgcggcggcttcttccgaggcgccagcggcgagtgcg
actgcagagcccgaggccggggaccaggacagtcgcgaggttcgagtgttgcagagcctg
cggggcaagatctgtgaagcaaaaaatttattgccatatcttggaccccacaaaatgaga
gattgtttctgtaccataaatttggaccaggaagaagtttatcgtacccaagttgtggaa
aaatctttaagcccatttttcagtgaagaattttactttgagattccaagaactttccag
tatttgtctttctatgtttatgataagaatgttttacaaagagatctccgtataggaaaa
gtagccatcaaaaaagaagacttgtgtaatcacagtggcaaagaaacttggttttcatta
cagcctgttgactccaattcagaggttcagggtaaagttcaccttgaattaaaactgaat
gaactgataacggagaatggaactgtatgccagcagcttgttgtacacatcaaggcatgc
catgggttgcctctcataaatggccaaagctgtgacccttatgcaacagtttctctagtg
ggcccttctaggaatgaccaaaagaagacaaaagtaaagaagaaaacaagcaatccgcag
tttaatgaaatcttttattttgaggtaaccagatccagtagttacaccagaaagtcccag
ttccaggtagaagaggaggacattgaaaagctagaaatcaggatcgacttgtggaacaat
ggaaacctagtccaagatgttttcctaggtgagattaaggttcctgtgaacgtattaaga
actgattcctctcatcaagcctggtacttgctacagccaagagacaatggaaacaagtca
tccaaaactgatgacctggggtctcttcgattaaatatatgttatacagaagactacgtg
cttccttcagagtactatggtcctttgaaaactttgctgctaaaatcaccagatgttcaa
ccaatatctgcctcagctgcttacattttgagtgaaatatgtcgagataaaaatgatgct
gttttgccccttgtacgactgctgctgcaccatgataaacttgttccttttgccactgct
gtggctgaattagacttgaaggatacacaagatgcaaacacaatttttagaggaaattcc
ctggctacccgatgtctggatgagatgatgaaaatagtgggagggcactacctgaaagta
acattaaaacctattcttgatgagatatgtgactcctcaaaatcctgtgaaatcgatcct
attaaattgaaagagggagataatgtagaaaataataaggagaatctgcgctactatgta
gacaagttattcaatacaattgtaaaatcaagtatgagctgccccactgtaatgtgtgat
atcttttattctctaaggcagatggctactcagagatttcctaatgaccctcatgttcag
tattctgcagtgagcagctttgtatttcttcgtttctttgctgtagccgtagtatcacct
catacttttcatttgcgacctcatcatccagatgcacagacaattagaacattaactctc
atctcaaaaactatacaaactttgggaagctgggggagtctgtccaaaagcaagtcaagt
ttcaaagagacattcatgtgtgaatttttcaaaatgtttcaagaagaaggatatattata
gcagttaaaaagttcttggatgaaatttcatctactgaaactaaagagtccagtggtacg
agtgagcctgtgcacctgaaagaaggtgagatgtataaaagagctcaaggaagaactcgg
attggaaaaaagaattttaagaaacgatggttctgcttaacaagcagagagctcacctac
cacaaacagccaggtagcaaagatgcaatctacacaatcccagtaaaaaacattcttgct
gtggaaaaactggaagagagctctttcaacaagaaaaatatgttccaagtaatacatacg
gagaaaccactctatgtccaggcaaataactgtgtagaagctaatgaatggatagacgta
ctctgcagggtgagccgatgcaatcaaaacaggctcagtttttatcatccctctgtgtat
ctgaacggaaattggctctgctgtcaggagactggtgaaaacactctcggctgcaagcca
tgtactgcaggtgtccctgcagacatccaaatagatattgatgaagacagagaaacagaa
agaatttattccctttttaccctcagtttacttaagctgcagaagatggaagaggcttgt
ggaactattgcagtctatcaaggaccacagaaagagcctgatgattattctaactttgta
atcgaggattctgtaacaacctttaagacaattcagcaaataaaaagcataattgagaag
ctggatgaacctcatgaaaaatataggaagaaaagatccagtagtgcaaaatatgggagc
aaggaaaatccaattgttgggaaagcatcttag

DBGET integrated database retrieval system