KEGG   Homo sapiens (human): 5925Help
Entry
5925              CDS       T01001                                 

Gene name
RB1, OSRC, PPP1R130, RB, p105-Rb, pRb, pp110
Definition
(RefSeq) RB transcriptional corepressor 1
  KO
K06618  retinoblastoma-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04110  Cell cycle
hsa04218  Cellular senescence
hsa04934  Cushing syndrome
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05212  Pancreatic cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06230  Cell cycle G1/S
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06270  Breast cancer
nt06272  Prostate cancer
nt06273  Glioma
nt06276  Chronic myeloid leukemia
nt06360  Cushing syndrome
  Element
N00066  MDM2-p21-Cell cycle G1/S
N00067  Deleted p14(ARF) to p21-cell cycle G1/S
N00068  Amplified MDM2 to p21-cell cycle G1/S
N00069  p16-Cell cycle G1/S
N00070  Mutation-inactivated p16(INK4a) to p16-cell cycle G1/S
N00071  Deleted p16(INK4a) to p16-cell cycle G1/S
N00072  Amplified CDK4 to cell cycle G1/S
N00073  Mutation-activated CDK4 to cell cycle G1/S
N00074  Loss of RB1 to cell cycle G1/S
N00075  Mutation-inactivated RB1 to cell cycle G1/S
N00076  Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00088  Amplified MYC to p15-cell cycle G1/S
N00089  Amplified MYC to cell cycle G1/S
N00090  p15-Cell cycle G1/S
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00093  Loss of CDKN1B to p27-cell cycle G1/S
N00167  KSHV vIRF1/3 to p21-cell cycle G1/S
N00168  KSHV vCyclin to cell cycle G1/S
N00169  KSHV LANA to p21-cell cycle G1/S
N00170  KSHV LANA to cell cycle G1/S
N00254  CDKN1B-reduced expression to p27-cell cycle G1/S
N00255  Amplified CCNE to cell cycle G1/S
N00264  EBV EBNA3C to p27-Cell cycle G1/S
N00275  Amplified CCND1 to cell cycle G1/S
N00316  Mutation-inactivated CDKN1B to p27-cell cycle G1/S
N00347  p300-p21-Cell cycle G1/S
N00348  HPV E6 to p300-p21-Cell cycle G1/S
N00349  HPV E6 to p300-p21-Cell cycle G1/S
N00358  HPV E6 to p21-cell cycle G1/S
N00359  HPV E7 to p27-cell cycle G1/S
N00360  HPV E7 to p27-cell cycle G1/S
N00361  HPV E7 to cell cycle G1/S
N00362  HPV E5 to p21-cell cycle G1/S
N00365  HPV E7 to cell cycle G1/S
N00420  HCMV IE2-86 to p21-cell cycle G1/S
N00421  HCMV IE2-86 to p21-cell cycle G1/S
N00422  HCMV IE2-86 to cell cycle G1/S
N00423  HCMV IE1-72 to cell cycle G1/S
N00424  HCMV pp71 to cell cycle G1/S
N00482  EBV EBNA3C to p27-Cell cycle G1/S
N00483  EBV EBNA3C to cell cycle G1/S
N00484  EBV EBNA3C to cell cycle G1/S
N00494  HTLV-1 Tax to p16-cell cycle G1/S
N00496  MDM2-p21-Cell cycle G1/S
N00497  HTLV-1 Tax to p21-cell cycle G1/S
N00498  HTLV-1 Tax to p21-cell cycle G1/S
N00521  HCV Core to p21-cell cycle G1/S
N00536  MDM2-p21-Cell cycle G1/S
N00537  HBV HBx to cell cycle G1/S
Disease
H00004  Chronic myeloid leukemia
H00013  Small cell lung cancer
H00017  Esophageal cancer
H00022  Bladder cancer
H00036  Osteosarcoma
H00042  Glioma
H00048  Hepatocellular carcinoma
H01513  Retinoblastoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5925 (RB1)
   04218 Cellular senescence
    5925 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5925 (RB1)
   05203 Viral carcinogenesis
    5925 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    5925 (RB1)
   05225 Hepatocellular carcinoma
    5925 (RB1)
   05226 Gastric cancer
    5925 (RB1)
   05214 Glioma
    5925 (RB1)
   05220 Chronic myeloid leukemia
    5925 (RB1)
   05218 Melanoma
    5925 (RB1)
   05219 Bladder cancer
    5925 (RB1)
   05215 Prostate cancer
    5925 (RB1)
   05224 Breast cancer
    5925 (RB1)
   05222 Small cell lung cancer
    5925 (RB1)
   05223 Non-small cell lung cancer
    5925 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    5925 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5925 (RB1)
   05161 Hepatitis B
    5925 (RB1)
   05160 Hepatitis C
    5925 (RB1)
   05163 Human cytomegalovirus infection
    5925 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5925 (RB1)
   05169 Epstein-Barr virus infection
    5925 (RB1)
   05165 Human papillomavirus infection
    5925 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5925 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5925 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5925 (RB1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5925 (RB1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    5925 (RB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rb_C RB_A RB_B DUF3452
Motif
Other DBs
NCBI-GeneID: 5925
NCBI-ProteinID: NP_000312
OMIM: 614041
HGNC: 9884
Ensembl: ENSG00000139687
Vega: OTTHUMG00000016900
Pharos: P06400(Tchem)
UniProt: P06400 A0A024RDV3
LinkDB All DBs
Structure
PDB: 

Position
13q14.2
AA seq 928 aa AA seqDB search
MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTAL
CQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTEL
QKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSS
ISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYK
TAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM
NSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKS
NLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVK
DIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDN
IFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEG
NLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH
TAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYL
RLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLK
FKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLS
PIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG
TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK
LAEMTSTRTRMQKQKMNDSMDTSNKEEK
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaaaccccccgaaaaacggccgccaccgccgccgctgccgccgcggaaccc
ccggcaccgccgccgccgccccctcctgaggaggacccagagcaggacagcggcccggag
gacctgcctctcgtcaggcttgagtttgaagaaacagaagaacctgattttactgcatta
tgtcagaaattaaagataccagatcatgtcagagagagagcttggttaacttgggagaaa
gtttcatctgtggatggagtattgggaggttatattcaaaagaaaaaggaactgtgggga
atctgtatctttattgcagcagttgacctagatgagatgtcgttcacttttactgagcta
cagaaaaacatagaaatcagtgtccataaattctttaacttactaaaagaaattgatacc
agtaccaaagttgataatgctatgtcaagactgttgaagaagtatgatgtattgtttgca
ctcttcagcaaattggaaaggacatgtgaacttatatatttgacacaacccagcagttcg
atatctactgaaataaattctgcattggtgctaaaagtttcttggatcacatttttatta
gctaaaggggaagtattacaaatggaagatgatctggtgatttcatttcagttaatgcta
tgtgtccttgactattttattaaactctcacctcccatgttgctcaaagaaccatataaa
acagctgttatacccattaatggttcacctcgaacacccaggcgaggtcagaacaggagt
gcacggatagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaagaa
catgaatgtaatatagatgaggtgaaaaatgtttatttcaaaaattttataccttttatg
aattctcttggacttgtaacatctaatggacttccagaggttgaaaatctttctaaacga
tacgaagaaatttatcttaaaaataaagatctagatgcaagattatttttggatcatgat
aaaactcttcagactgattctatagacagttttgaaacacagagaacaccacgaaaaagt
aaccttgatgaagaggtgaatgtaattcctccacacactccagttaggactgttatgaac
actatccaacaattaatgatgattttaaattcagcaagtgatcaaccttcagaaaatctg
atttcctattttaacaactgcacagtgaatccaaaagaaagtatactgaaaagagtgaag
gatataggatacatctttaaagagaaatttgctaaagctgtgggacagggttgtgtcgaa
attggatcacagcgatacaaacttggagttcgcttgtattaccgagtaatggaatccatg
cttaaatcagaagaagaacgattatccattcaaaattttagcaaacttctgaatgacaac
atttttcatatgtctttattggcgtgcgctcttgaggttgtaatggccacatatagcaga
agtacatctcagaatcttgattctggaacagatttgtctttcccatggattctgaatgtg
cttaatttaaaagcctttgatttttacaaagtgatcgaaagttttatcaaagcagaaggc
aacttgacaagagaaatgataaaacatttagaacgatgtgaacatcgaatcatggaatcc
cttgcatggctctcagattcacctttatttgatcttattaaacaatcaaaggaccgagaa
ggaccaactgatcaccttgaatctgcttgtcctcttaatcttcctctccagaataatcac
actgcagcagatatgtatctttctcctgtaagatctccaaagaaaaaaggttcaactacg
cgtgtaaattctactgcaaatgcagagacacaagcaacctcagccttccagacccagaag
ccattgaaatctacctctctttcactgttttataaaaaagtgtatcggctagcctatctc
cggctaaatacactttgtgaacgccttctgtctgagcacccagaattagaacatatcatc
tggacccttttccagcacaccctgcagaatgagtatgaactcatgagagacaggcatttg
gaccaaattatgatgtgttccatgtatggcatatgcaaagtgaagaatatagaccttaaa
ttcaaaatcattgtaacagcatacaaggatcttcctcatgctgttcaggagacattcaaa
cgtgttttgatcaaagaagaggagtatgattctattatagtattctataactcggtcttc
atgcagagactgaaaacaaatattttgcagtatgcttccaccaggccccctaccttgtca
ccaatacctcacattcctcgaagcccttacaagtttcctagttcacccttacggattcct
ggagggaacatctatatttcacccctgaagagtccatataaaatttcagaaggtctgcca
acaccaacaaaaatgactccaagatcaagaatcttagtatcaattggtgaatcattcggg
acttctgagaagttccagaaaataaatcagatggtatgtaacagcgaccgtgtgctcaaa
agaagtgctgaaggaagcaaccctcctaaaccactgaaaaaactacgctttgatattgaa
ggatcagatgaagcagatggaagtaaacatctcccaggagagtccaaatttcagcagaaa
ctggcagaaatgacttctactcgaacacgaatgcaaaagcagaaaatgaatgatagcatg
gatacctcaaacaaggaagagaaatga

KEGG   Homo sapiens (human): 5933Help
Entry
5933              CDS       T01001                                 

Gene name
RBL1, CP107, PRB1, p107
Definition
(RefSeq) RB transcriptional corepressor like 1
  KO
K04681  retinoblastoma-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04218  Cellular senescence
hsa04350  TGF-beta signaling pathway
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
Network
nt06130  Cell cycle (virus)
nt06166  Human papillomavirus (HPV)
  Element
N00361  HPV E7 to cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    5933 (RBL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5933 (RBL1)
   04218 Cellular senescence
    5933 (RBL1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    5933 (RBL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5933 (RBL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5933 (RBL1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    5933 (RBL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RB_A RB_B DUF3452 Rb_C ATLF
Motif
Other DBs
NCBI-GeneID: 5933
NCBI-ProteinID: NP_002886
OMIM: 116957
HGNC: 9893
Ensembl: ENSG00000080839
Vega: OTTHUMG00000032406
Pharos: P28749(Tbio)
UniProt: P28749
LinkDB All DBs
Structure
PDB: 

Position
20q11.23
AA seq 1068 aa AA seqDB search
MFEDKPHAEGAAVVAAAGEALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVTHWLA
CSLYVACRKSIIPTVGKGIMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRE
RIERLERNFEVSTVIFKKYEPIFLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTL
FVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIMCPNRQDLLNPSFKGLPSDFHTADFT
ASEEPPCIIAVLCELHDGLLVEAKGIKEHYFKPYISKLFDRKILKGECLLDLSSFTDNSK
AVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFTRDTPLGKLTAQANVEYNLQQHFE
KKRSFAPSTPLTGRRYLREKEAVITPVASATQSVSRLQSIVAGLKNAPSDQLINIFESCV
RNPVENIMKILKGIGETFCQHYTQSTDEQPGSHIDFAVNRLKLAEILYYKILETVMVQET
RRLHGMDMSVLLEQDIFHRSLMACCLEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVV
IRSEEGLSRDMVKHLNSIEEQILESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETG
NGGNVQGHLPLMPMSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHERYSSPTAGSAKRRL
FGEDPPKEMLMDKIITEGTKLKIAPSSSITAENVSILPGQTLLTMATAPVTGTTGHKVTI
PLHGVANDAGEITLIPLSMNTNQESKVKSPVSLTAHSLIGASPKQTNLTKAQEVHSTGIN
RPKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHL
DQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKSIPREVVAYNKNIND
DFEMIDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDA
PPLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSGLTPRSALLYKFNGSPSKSLKDINNM
IRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaggacaagccccacgctgagggggcggcggtggtcgccgcagccggggaggcg
ctacaggccctgtgccaggagctgaacctggacgaggggagcgcggccgaagccctggac
gactttactgccatccgaggcaactacagcctagagggagaagttacacactggttggca
tgttcattatatgttgcatgccgcaaaagcattattcccacggttggaaagggtatcatg
gaaggcaactgtgtttcacttaccagaatactacgttcagctaaattaagtttaatacaa
ttttttagtaaaatgaagaaatggatggacatgtcaaatctaccacaagaatttcgtgaa
cgtatagaaaggctagagagaaattttgaggtgtctactgtaatattcaaaaaatatgag
ccaatttttttagatatatttcaaaatccatatgaagaaccaccaaagttaccacgaagc
cggaagcagaggaggattccttgcagtgttaaggatctgtttaatttctgttggacactt
tttgtttatactaagggtaattttcggatgattggggatgacttagtaaactcttatcat
ttacttctatgctgcttggatctgatttttgccaatgcgattatgtgcccaaatagacaa
gacttgctaaatccatcatttaaaggtttaccatctgattttcatactgctgactttacg
gcttctgaagagccaccctgcatcattgctgtactgtgtgaactgcatgatggacttctc
gtagaagcaaaaggaataaaggagcactactttaagccatatatttcaaaactctttgac
aggaagatattaaaaggagaatgcctcctggacctttcaagttttactgataatagcaaa
gcagtgaataaggagtatgaagagtatgttctaactgttggtgattttgatgagaggatc
tttttgggagcagacgcagaagaggaaattggaacacctcgaaagttcactcgtgacacc
ccattagggaaactgacagcacaggctaatgtggagtataaccttcaacagcactttgaa
aaaaaaaggtcatttgcaccttctaccccactgaccggacggagatatttacgagaaaaa
gaagcagtcattactcctgttgcatcagccacccaaagtgtgagccggttacagagtatt
gtggctggtctgaaaaatgcaccaagtgaccaacttataaatatttttgaatcttgtgtg
cgtaatcctgtggaaaacattatgaaaatactaaaaggaataggagagactttctgtcaa
cactatactcaatcaacagatgaacagccaggatctcacatagactttgctgtaaacaga
ctaaagctggcagaaattttgtattataaaatactagagactgtaatggttcaggaaaca
cgaagacttcatggaatggacatgtcagttcttttagagcaagatatatttcatcgttcc
ttgatggcttgttgtttggaaattgtgctctttgcctatagctcacctcgtacttttcct
tggattattgaagttctcaacttgcaaccattttacttttataaggttattgaggtggtg
atccgctcagaagaggggctctcaagggacatggtgaaacacctaaacagcattgaagaa
cagattttggagagtttagcatggagtcacgattctgcactgtgggaggctctccaggtt
tctgcaaacaaagttcctacctgtgaagaagttatattcccaaataactttgaaacagga
aatggaggaaatgtgcagggacatcttcccctgatgccaatgtctcctctaatgcaccca
agagtcaaggaagttcgaactgacagtgggagtcttcgaagagatatgcaaccattgtct
ccaatttctgtccatgaacgctacagttctcctaccgcagggagtgctaagagaagactc
tttggagaggaccccccaaaggaaatgcttatggacaagatcataacagaaggaacaaaa
ttgaaaatcgctccttcttcaagcattactgctgaaaatgtatcaattttacctggtcaa
actcttctaacaatggccacagccccagtaacaggaacaacaggacataaagttacaatt
ccattacatggtgtcgcaaatgatgctggagagatcacactgatacctctttccatgaat
acaaatcaggagtccaaagtcaagagtcctgtatcacttactgctcattcattaattggt
gcttctccaaaacagaccaatctgactaaagcacaagaggtacattcaactggaataaac
aggccaaagagaactgggtccttagcactattttacagaaaggtctatcatttggcaagt
gtacgcttacgtgatctatgtctaaaactggatgtttcaaatgagttacgaaggaagata
tggacgtgttttgaattcactttagttcactgtcctgatctaatgaaagacaggcatttg
gatcagctcctcctttgtgccttttatatcatggcaaaggtaacaaaagaagaaagaact
tttcaagaaattatgaaaagttataggaatcagccccaagctaatagtcacgtatataga
agtgttctgctgaaaagtattccaagagaagttgtggcatataataaaaatataaatgat
gactttgaaatgatagattgtgacttagaagatgctacaaaaacacctgactgttccagt
ggaccagtgaaagaggaaagaggtgatcttataaaattttacaatacaatatatgtagga
agagtgaagtcatttgcactgaaatacgacttggcgaatcaggaccatatgatggatgct
ccaccactctctccttttccacatattaaacaacagccaggctcaccacgccgcatttcc
cagcagcactccatttatatttccccgcacaagaatgggtcaggccttacaccaagaagc
gctctgctgtacaagttcaatggcagcccttctaagagtttgaaagatatcaacaacatg
ataaggcaaggtgagcagagaaccaagaagcgagtaatagccatcgatagtgatgcagaa
tcccctgccaaacgcgtctgtcaagaaaatgatgacgttttactgaaacgactacaggat
gttgtcagtgaaagagcaaatcattaa

KEGG   Homo sapiens (human): 5934Help
Entry
5934              CDS       T01001                                 

Gene name
RBL2, P130, Rb2
Definition
(RefSeq) RB transcriptional corepressor like 2
  KO
K16332  retinoblastoma-like protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
Network
nt06130  Cell cycle (virus)
nt06166  Human papillomavirus (HPV)
  Element
N00361  HPV E7 to cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    5934 (RBL2)
   04151 PI3K-Akt signaling pathway
    5934 (RBL2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5934 (RBL2)
   04218 Cellular senescence
    5934 (RBL2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    5934 (RBL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5934 (RBL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5934 (RBL2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    5934 (RBL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RB_A RB_B DUF3452 TFIIB SLH
Motif
Other DBs
NCBI-GeneID: 5934
NCBI-ProteinID: NP_001310537
OMIM: 180203
HGNC: 9894
Ensembl: ENSG00000103479
Vega: OTTHUMG00000133198
Pharos: Q08999(Tbio)
UniProt: Q08999
LinkDB All DBs
Position
16q12.2
AA seq 1139 aa AA seqDB search
MPSGGDQSPPPPPPPPAAAASDEEEEDDGEAEDAAPPAESPTPQIQQRFDELCSRLNMDE
AARAEAWDSYRSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTVEGNYVSLTRILKC
SEQSLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEE
QPRQQRGRKQRRQPCTVSEIFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGNA
LQCSNRKELVNPNFKGLSEDFHAKDSKPSSDPPCIIEKLCSLHDGLVLEAKGIKEHFWKP
YIRKLYEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEEYVLSVGNLDERIFLGEDAEE
EIGTLSRCLNAGSGTETAERVQMKNILQQHFDKSKALRISTPLTGVRYIKENSPCVTPVS
TATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDF
SNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVV
TFSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWK
PESPLWEKIRDNENRVPTCEEVMPPQNLERADEICIAGSPLTPRRVTEVRADTGGLGRSI
TSPTTLYDRYSSPPASTTRRRLFVENDSPSDGGTPGRMPPQPLVNAVPVQNVSGETVSVT
PVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVTGSIQPL
SAQALAGSLSSQQVTGTTLQVPGQVAIQQISPGGQQQKQGQSVTSSSNRPRKTSSLSLFF
RKVYHLAAVRLRDLCAKLDISDELRKKIWTCFEFSIIQCPELMMDRHLDQLLMCAIYVMA
KVTKEDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRKRRNSGSSDSRSHQNSPTELNKDR
TSRDSSPVMRSSSTLPVPQPSSAPPTPTRLTGANSDMEEEERGDLIQFYNNIYIKQIKTF
AMKYSQANMDAPPLSPYPFVRTGSPRRIQLSQNHPVYISPHKNETMLSPREKIFYYFSNS
PSKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQDVANDRGSH
NT seq 3420 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgggaggtgaccagtcgccaccgcccccgcctccccctccggcggcggcagcc
tcggatgaggaggaggaggacgacggcgaggcggaagacgccgcgccgcctgccgagtcg
cccacccctcagatccagcagcggttcgacgagctgtgcagccgcctcaacatggacgag
gcggcgcgggccgaggcctgggacagctaccgcagcatgagcgaaagctacacgctggag
ggaaatgatcttcattggttagcatgtgccttatatgtggcttgcagaaaatctgttcca
actgtaagcaaagggacagtggaaggaaactatgtatctttaactagaatcctgaaatgt
tcagagcagagcttaatcgaattttttaataagatgaagaagtgggaagacatggcaaat
ctacccccacatttcagagaacgtactgagagattagaaagaaacttcactgtttctgct
gtaatttttaagaaatatgaacccatttttcaggacatctttaaataccctcaagaggag
caacctcgtcagcagcgaggaaggaaacagcggcgacagccctgtactgtgtctgaaatt
ttccatttttgttgggtgctttttatatatgcaaaaggtaatttccccatgattagtgat
gatttggtcaattcttatcacctgctgctgtgtgctttggacttagtttatggaaatgca
cttcagtgttctaatcgtaaagaacttgtgaaccctaattttaaaggcttatctgaagat
tttcatgctaaagattctaaaccttcctctgaccccccttgtatcattgagaaactgtgt
tccttacatgatggcctagttttggaagcaaaggggataaaggaacatttctggaaaccc
tatattaggaaactttatgaaaaaaagctccttaagggaaaagaagaaaatctcactggg
tttctagaacctgggaactttggagagagttttaaagccatcaataaggcctatgaggag
tatgttttatctgttgggaatttagatgagcggatatttcttggagaggatgctgaggag
gaaattgggactctctcaaggtgtctgaacgctggttcaggaacagagactgctgaaagg
gtgcagatgaaaaacatcttacagcagcattttgacaagtccaaagcacttagaatctcc
acaccactaactggtgttaggtacattaaggagaatagcccttgtgtgactccagtttct
acagctacgcatagcttgagtcgtcttcacaccatgctgacaggcctcaggaatgcacca
agtgagaaactggaacagattctcaggacatgttccagagatccaacccaggctattgct
aacagactgaaagaaatgtttgaaatatattctcagcatttccagccagacgaggatttc
agtaattgtgctaaagaaattgccagcaaacattttcgttttgcggagatgctttactat
aaagtattagaatctgttattgagcaggaacaaaaaagactaggagacatggatttatct
ggtattctggaacaagatgcgttccacagatctctcttggcctgctgccttgaggtcgtc
actttttcttataagcctcctgggaattttccatttattactgaaatatttgatgtgcct
ctttatcatttttataaggtgatagaagtattcattagagcagaagatggcctttgtaga
gaggtggtaaaacaccttaatcagattgaagaacagatcttagatcatttggcatggaaa
ccagagtctccactctgggaaaaaattagagacaatgaaaacagagttcctacatgtgaa
gaggtcatgccacctcagaacctggaaagggcagatgaaatttgcattgctggctcccct
ttgactcccagaagggtgactgaagttcgtgctgatactggaggacttggaaggagcata
acatctccaaccacattatacgataggtacagctccccaccagccagcactaccagaagg
cggctatttgttgagaatgatagcccctctgatggagggacgcctgggcgcatgccccca
cagcccctagtcaatgctgtccctgtgcagaatgtatctggggagactgtttctgtcaca
ccagttcctggacagactttggtcaccatggcaaccgccactgtcacagccaacaatggg
caaacggtaaccattcctgtgcaaggtattgccaatgaaaatggagggataacattcttc
cctgtccaagtcaatgttggggggcaggcacaagctgtgacaggctccatccagcccctc
agtgctcaggccctggctggaagtctgagctctcaacaggtgacaggaacaactttgcaa
gtccctggtcaagtggccattcaacagatttccccaggtggccaacagcagaagcaaggc
cagtctgtaaccagcagtagtaatagacccaggaagaccagctctttatcgcttttcttt
agaaaggtataccatttagcagctgtccgccttcgggatctctgtgccaaactagatatt
tcagatgaattgaggaaaaaaatctggacctgctttgaattctccataattcagtgtcct
gaacttatgatggacagacatctggaccagttattaatgtgtgccatttatgtgatggca
aaggtcacaaaagaagataagtccttccagaacattatgcgttgttataggactcagccg
caggcccggagccaggtgtatagaagtgttttgataaaagggaaaagaaaaagaagaaat
tctggcagcagtgatagcagaagccatcagaattctccaacagaactaaacaaagataga
accagtagagactccagtccagttatgaggtcaagcagcaccttgccagttccacagccc
agcagtgctcctcccacacctactcgcctcacaggtgccaacagtgacatggaagaagag
gagaggggagacctcattcagttctacaacaacatctacatcaaacagattaagacattt
gccatgaagtactcacaggcaaatatggatgctcctccactctctccctatccatttgta
agaacaggctcccctcgccgaatacagttgtctcaaaatcatcctgtctacatttcccca
cataaaaatgaaacaatgctttctcctcgagaaaagattttctattacttcagcaacagt
ccttcaaagagactgagagaaattaatagtatgatacgcacaggagaaactcctactaaa
aagagaggaattcttttggaagatggaagtgaatcacctgcaaaaagaatttgcccagaa
aatcattctgccttattacgccgtctccaagatgtagctaatgaccgtggttcccactga

DBGET integrated database retrieval system