KEGG   Homo sapiens (human): 59277Help
Entry
59277             CDS       T01001                                 

Gene name
NTN4, PRO3091
Definition
(RefSeq) netrin 4
  KO
K06845  netrin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    59277 (NTN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_N Laminin_EGF NTR F5_F8_type_C BNR_6
Motif
Other DBs
NCBI-GeneID: 59277
NCBI-ProteinID: NP_067052
OMIM: 610401
HGNC: 13658
Ensembl: ENSG00000074527
Vega: OTTHUMG00000170290
Pharos: Q9HB63(Tbio)
UniProt: Q9HB63
LinkDB All DBs
Position
12q22
AA seq 628 aa AA seqDB search
MGSCARLLLLWGCTVVAAGLSGVAGVSSRCEKACNPRMGNLALGRKLWADTTCGQNATEL
YCFYSENTDLTCRQPKCDKCNAAYPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLD
LEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKYFATNCSATFGLEDDVVKKGAI
CTSKYSSPFPCTGGEVIFKALSPPYDTENPYSAKVQEQLKITNLRVQLLKRQSCPCQRND
LNEEPQHFTHYAIYDFIVKGSCFCNGHADQCIPVHGFRPVKAPGTFHMVHGKCMCKHNTA
GSHCQHCAPLYNDRPWEAADGKTGAPNECRTCKCNGHADTCHFDVNVWEASGNRSGGVCD
DCQHNTEGQYCQRCKPGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDC
PCKPGVAGRRCDRCMVGYWGFGDYGCRPCDCAGSCDPITGDCISSHTDIDWYHEVPDFRP
VHNKSEPAWEWEDAQGFSALLHSGKCECKEQTLGNAKAFCGMKYSYVLKIKILSAHDKGT
HVEVNVKIKKVLKSTKLKIFRGKRTLYPESWTDRGCTCPILNPGLEYLVAGHEDIRTGKL
IVNMKSFVQHWKPSLGRKVMDILKRECK
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggggagctgcgcgcggctgctgctgctctggggctgcacggtggtggccgcaggactg
agtggagtagctggagtgagttcccgctgtgaaaaagcctgcaaccctcggatgggaaat
ttggctttggggcgaaaactctgggcagacaccacctgcggtcagaatgctaccgaactg
tactgcttctacagtgagaacacggatctgacttgtcggcagcccaaatgtgacaagtgc
aatgctgcctatcctcacctggctcacctgccatctgccatggcagactcatccttccgg
tttcctcgcacatggtggcagtctgcggaggatgtgcacagagaaaagatccagttagac
ctggaagctgaattctacttcactcacctaattgtgatgttcaagtcccccaggccggct
gccatggtgctggaccgctcccaggactttgggaaaacatggaagccttataagtacttt
gcgactaactgctccgctacatttggcctggaagatgatgttgtcaagaagggcgctatt
tgtacttctaaatactccagtccttttccatgcactggaggagaggttattttcaaagct
ttgtcaccaccatacgatacagagaacccttacagtgccaaagttcaggagcagctgaag
atcaccaaccttcgcgtgcagctgctgaaacgacagtcttgtccctgtcagagaaatgac
ctgaacgaagagcctcaacattttacacactatgcaatctatgatttcattgtcaagggc
agctgcttctgcaatggccacgctgatcaatgcatacctgttcatggcttcagacctgtc
aaggccccaggaacattccacatggtccatgggaagtgtatgtgtaagcacaacacagca
ggcagccactgccagcactgtgccccgttatacaatgaccggccatgggaggcagctgat
ggcaaaacgggggctcccaacgagtgcagaacctgcaagtgtaatgggcatgctgatacc
tgtcacttcgacgttaatgtgtgggaggcatcagggaatcgtagtggtggtgtctgtgat
gactgtcagcacaacacagaaggacagtattgccagaggtgcaagccaggcttctatcgt
gacctgcggagacccttctcagctccagatgcttgcaaaccgtgttcctgccatccagta
ggatcagctgtccttcctgccaactcagtgaccttctgcgaccccagcaatggtgactgc
ccttgcaagcctggggtggcagggcgacgttgtgacaggtgcatggtgggatactggggc
ttcggagactatggctgtcgaccatgtgactgtgcggggagctgtgaccctatcaccgga
gactgcatcagcagccacacagacatagactggtatcatgaagttcctgacttccgtccc
gtgcacaataagagcgaaccagcctgggagtgggaggatgcgcaggggttttctgcactt
ctacactcaggtaaatgcgaatgtaaggaacagacattaggaaatgccaaggcattctgt
ggaatgaaatattcatatgtgctaaaaataaagattttatcagctcatgataaaggtact
catgttgaggtcaatgtgaagattaaaaaggtcttaaaatctaccaaactgaagattttc
cgaggaaagcgaacattatatccagaatcatggacggacagaggatgcacttgtccaatc
ctcaatcctggtttggaataccttgtagcaggacatgaggatataagaacaggcaaacta
attgtgaatatgaaaagctttgtccagcactggaaaccttctcttggaagaaaagtcatg
gatattttaaaaagagagtgcaagtag

DBGET integrated database retrieval system