KEGG   Homo sapiens (human): 5934Help
Entry
5934              CDS       T01001                                 

Gene name
RBL2, P130, Rb2
Definition
(RefSeq) RB transcriptional corepressor like 2
  KO
K16332  retinoblastoma-like protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
Network
nt06130  Cell cycle (virus)
nt06166  Human papillomavirus (HPV)
  Element
N00361  HPV E7 to cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    5934 (RBL2)
   04151 PI3K-Akt signaling pathway
    5934 (RBL2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5934 (RBL2)
   04218 Cellular senescence
    5934 (RBL2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    5934 (RBL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5934 (RBL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5934 (RBL2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain Rb
    5934 (RBL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RB_A RB_B DUF3452 TFIIB SLH
Motif
Other DBs
NCBI-GeneID: 5934
NCBI-ProteinID: NP_001310537
OMIM: 180203
HGNC: 9894
Ensembl: ENSG00000103479
Vega: OTTHUMG00000133198
Pharos: Q08999(Tbio)
UniProt: Q08999
LinkDB All DBs
Position
16q12.2
AA seq 1139 aa AA seqDB search
MPSGGDQSPPPPPPPPAAAASDEEEEDDGEAEDAAPPAESPTPQIQQRFDELCSRLNMDE
AARAEAWDSYRSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTVEGNYVSLTRILKC
SEQSLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEE
QPRQQRGRKQRRQPCTVSEIFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGNA
LQCSNRKELVNPNFKGLSEDFHAKDSKPSSDPPCIIEKLCSLHDGLVLEAKGIKEHFWKP
YIRKLYEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEEYVLSVGNLDERIFLGEDAEE
EIGTLSRCLNAGSGTETAERVQMKNILQQHFDKSKALRISTPLTGVRYIKENSPCVTPVS
TATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDF
SNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVV
TFSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWK
PESPLWEKIRDNENRVPTCEEVMPPQNLERADEICIAGSPLTPRRVTEVRADTGGLGRSI
TSPTTLYDRYSSPPASTTRRRLFVENDSPSDGGTPGRMPPQPLVNAVPVQNVSGETVSVT
PVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVTGSIQPL
SAQALAGSLSSQQVTGTTLQVPGQVAIQQISPGGQQQKQGQSVTSSSNRPRKTSSLSLFF
RKVYHLAAVRLRDLCAKLDISDELRKKIWTCFEFSIIQCPELMMDRHLDQLLMCAIYVMA
KVTKEDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRKRRNSGSSDSRSHQNSPTELNKDR
TSRDSSPVMRSSSTLPVPQPSSAPPTPTRLTGANSDMEEEERGDLIQFYNNIYIKQIKTF
AMKYSQANMDAPPLSPYPFVRTGSPRRIQLSQNHPVYISPHKNETMLSPREKIFYYFSNS
PSKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQDVANDRGSH
NT seq 3420 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgggaggtgaccagtcgccaccgcccccgcctccccctccggcggcggcagcc
tcggatgaggaggaggaggacgacggcgaggcggaagacgccgcgccgcctgccgagtcg
cccacccctcagatccagcagcggttcgacgagctgtgcagccgcctcaacatggacgag
gcggcgcgggccgaggcctgggacagctaccgcagcatgagcgaaagctacacgctggag
ggaaatgatcttcattggttagcatgtgccttatatgtggcttgcagaaaatctgttcca
actgtaagcaaagggacagtggaaggaaactatgtatctttaactagaatcctgaaatgt
tcagagcagagcttaatcgaattttttaataagatgaagaagtgggaagacatggcaaat
ctacccccacatttcagagaacgtactgagagattagaaagaaacttcactgtttctgct
gtaatttttaagaaatatgaacccatttttcaggacatctttaaataccctcaagaggag
caacctcgtcagcagcgaggaaggaaacagcggcgacagccctgtactgtgtctgaaatt
ttccatttttgttgggtgctttttatatatgcaaaaggtaatttccccatgattagtgat
gatttggtcaattcttatcacctgctgctgtgtgctttggacttagtttatggaaatgca
cttcagtgttctaatcgtaaagaacttgtgaaccctaattttaaaggcttatctgaagat
tttcatgctaaagattctaaaccttcctctgaccccccttgtatcattgagaaactgtgt
tccttacatgatggcctagttttggaagcaaaggggataaaggaacatttctggaaaccc
tatattaggaaactttatgaaaaaaagctccttaagggaaaagaagaaaatctcactggg
tttctagaacctgggaactttggagagagttttaaagccatcaataaggcctatgaggag
tatgttttatctgttgggaatttagatgagcggatatttcttggagaggatgctgaggag
gaaattgggactctctcaaggtgtctgaacgctggttcaggaacagagactgctgaaagg
gtgcagatgaaaaacatcttacagcagcattttgacaagtccaaagcacttagaatctcc
acaccactaactggtgttaggtacattaaggagaatagcccttgtgtgactccagtttct
acagctacgcatagcttgagtcgtcttcacaccatgctgacaggcctcaggaatgcacca
agtgagaaactggaacagattctcaggacatgttccagagatccaacccaggctattgct
aacagactgaaagaaatgtttgaaatatattctcagcatttccagccagacgaggatttc
agtaattgtgctaaagaaattgccagcaaacattttcgttttgcggagatgctttactat
aaagtattagaatctgttattgagcaggaacaaaaaagactaggagacatggatttatct
ggtattctggaacaagatgcgttccacagatctctcttggcctgctgccttgaggtcgtc
actttttcttataagcctcctgggaattttccatttattactgaaatatttgatgtgcct
ctttatcatttttataaggtgatagaagtattcattagagcagaagatggcctttgtaga
gaggtggtaaaacaccttaatcagattgaagaacagatcttagatcatttggcatggaaa
ccagagtctccactctgggaaaaaattagagacaatgaaaacagagttcctacatgtgaa
gaggtcatgccacctcagaacctggaaagggcagatgaaatttgcattgctggctcccct
ttgactcccagaagggtgactgaagttcgtgctgatactggaggacttggaaggagcata
acatctccaaccacattatacgataggtacagctccccaccagccagcactaccagaagg
cggctatttgttgagaatgatagcccctctgatggagggacgcctgggcgcatgccccca
cagcccctagtcaatgctgtccctgtgcagaatgtatctggggagactgtttctgtcaca
ccagttcctggacagactttggtcaccatggcaaccgccactgtcacagccaacaatggg
caaacggtaaccattcctgtgcaaggtattgccaatgaaaatggagggataacattcttc
cctgtccaagtcaatgttggggggcaggcacaagctgtgacaggctccatccagcccctc
agtgctcaggccctggctggaagtctgagctctcaacaggtgacaggaacaactttgcaa
gtccctggtcaagtggccattcaacagatttccccaggtggccaacagcagaagcaaggc
cagtctgtaaccagcagtagtaatagacccaggaagaccagctctttatcgcttttcttt
agaaaggtataccatttagcagctgtccgccttcgggatctctgtgccaaactagatatt
tcagatgaattgaggaaaaaaatctggacctgctttgaattctccataattcagtgtcct
gaacttatgatggacagacatctggaccagttattaatgtgtgccatttatgtgatggca
aaggtcacaaaagaagataagtccttccagaacattatgcgttgttataggactcagccg
caggcccggagccaggtgtatagaagtgttttgataaaagggaaaagaaaaagaagaaat
tctggcagcagtgatagcagaagccatcagaattctccaacagaactaaacaaagataga
accagtagagactccagtccagttatgaggtcaagcagcaccttgccagttccacagccc
agcagtgctcctcccacacctactcgcctcacaggtgccaacagtgacatggaagaagag
gagaggggagacctcattcagttctacaacaacatctacatcaaacagattaagacattt
gccatgaagtactcacaggcaaatatggatgctcctccactctctccctatccatttgta
agaacaggctcccctcgccgaatacagttgtctcaaaatcatcctgtctacatttcccca
cataaaaatgaaacaatgctttctcctcgagaaaagattttctattacttcagcaacagt
ccttcaaagagactgagagaaattaatagtatgatacgcacaggagaaactcctactaaa
aagagaggaattcttttggaagatggaagtgaatcacctgcaaaaagaatttgcccagaa
aatcattctgccttattacgccgtctccaagatgtagctaatgaccgtggttcccactga

DBGET integrated database retrieval system