KEGG   Homo sapiens (human): 59343Help
Entry
59343             CDS       T01001                                 

Gene name
SENP2, AXAM2, SMT3IP2
Definition
(RefSeq) SUMO specific peptidase 2
  KO
K03345  sentrin-specific protease 2 (axin associating molecule) [EC:3.4.22.68]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    59343 (SENP2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    59343 (SENP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    59343 (SENP2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    59343 (SENP2)
   04121 Ubiquitin system [BR:hsa04121]
    59343 (SENP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.68  Ulp1 peptidase
     59343 (SENP2)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C48: Ulp1 endopeptidase family
   59343 (SENP2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     59343 (SENP2)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   59343 (SENP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C48
Motif
Other DBs
NCBI-GeneID: 59343
NCBI-ProteinID: NP_067640
OMIM: 608261
HGNC: 23116
Ensembl: ENSG00000163904
Vega: OTTHUMG00000156658
Pharos: Q9HC62(Tbio)
UniProt: Q9HC62
LinkDB All DBs
Structure
PDB: 

Position
3q27.2
AA seq 589 aa AA seqDB search
MYRWLVRILGTIFRFCDRSVPPARALLKRRRSDSTLFSTVDTDEIPAKRPRLDCFIHQVK
NSLYNAASLFGFPFQLTTKPMVTSACNGTRNVAPSGEVFSNSSSCELTGSGSWNNMLKLG
NKSPNGISDYPKIRVTVTRDQPRRVLPSFGFTLNSEGCNRRPGGRRHSKGNPESSLMWKP
QEQAVTEMISEESGKGLRRPHCTVEEGVQKEEREKYRKLLERLKESGHGNSVCPVTSNYH
SSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRGPLCSLRSEKRCSKGKITDTE
TMVGIRFENESRRGYQLEPDLSEEVSARLRLGSGSNGLLRRKVSIIETKEKNCSGKERDR
RTDDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYM
NLLVERNKKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWS
LVVIDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIP
QQLNGSDCGMFTCKYADYISRDKPITFTQHQMPLFRKKMVWEILHQQLL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgtacagatggctggttaggattctcggcaccattttccgtttctgcgaccggtcggtg
ccccctgcccgggccctcctgaagaggcggcgctcagacagcactctgttttctacagtg
gacactgatgaaataccagccaaaagaccaagattagattgctttattcaccaagtgaaa
aacagtctctacaatgctgccagcttatttggattcccattccagctgaccacaaagccc
atggtaacttctgcttgtaatggaacacggaatgtggccccttcaggagaggtattttcg
aactcttcatcttgtgaactgacaggttctggatcctggaacaacatgctgaaactgggt
aataaatctcctaatggaataagtgactatccaaagatcagagtgacagttacccgagat
cagccacgcagagtcctgccttcctttggttttactttgaactcagaaggctgtaataga
agaccaggtggccgtcgccatagcaaaggtaatccagagagttctttaatgtggaaacct
caggaacaggctgtaacagagatgatttctgaagagagtggcaagggtctgaggcgtccc
cattgtactgtggaggagggtgttcaaaaagaggaaagagagaagtaccgaaagttattg
gaacgacttaaagaaagtggtcatggaaactctgtctgtcctgtaacttcaaattatcac
agttctcaaagaagtcagatggacacattaaagaccaaaggctggggggaagagcaaaat
cacggagtcaaaacaactcagtttgttccaaaacaatatagacttgttgaaacaagggga
cctctatgttcattgagaagtgaaaagaggtgttcaaaggggaaaattactgatacagag
acgatggtcggaatcagatttgaaaatgaaagtaggaggggataccaactggagcctgac
ctatcagaagaagtgtcggcccgactccgcctgggcagtggaagcaatggcttactcagg
aggaaagtgtcaataattgagacaaaggaaaagaattgctcaggcaaagagagggacaga
agaacggacgatctccttgaacttacagaggacatggaaaaggaaatcagtaatgcccta
ggccatggcccacaggatgaaatcctaagtagtgctttcaaattgcgaattactcgagga
gatattcagacattaaagaactatcactggctcaatgatgaagtcattaatttttacatg
aatcttctggtggaaagaaataaaaagcaaggctatccagcacttcatgtattcagtact
ttcttctatcctaaattaaagtctgggggttaccaagcagtgaaacgatggaccaaaggg
gtaaatctctttgaacaagaaattattctggtgcctattcatcggaaggtacattggagc
ctggtggtgattgacctaagaaaaaagtgtcttaaatatctggattctatgggacaaaag
ggccacaggatctgtgagattctccttcagtatttacaggatgaaagtaagaccaaaaga
aatagtgatctgaatcttttagagtggacccatcacagcatgaaaccacacgagattcct
caacagctgaatgggagtgattgtggaatgtttacttgtaaatatgcagattatatttct
agggacaaacctatcacatttactcagcaccagatgcctctcttccggaagaagatggtg
tgggaaatccttcatcagcagttgctgtga

DBGET integrated database retrieval system