KEGG   Homo sapiens (human): 596Help
Entry
596               CDS       T01001                                 

Gene name
BCL2, Bcl-2, PPP1R50
Definition
(RefSeq) BCL2 apoptosis regulator
  KO
K02161  apoptosis regulator Bcl-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04064  NF-kappa B signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04115  p53 signaling pathway
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04340  Hedgehog signaling pathway
hsa04510  Focal adhesion
hsa04621  NOD-like receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04725  Cholinergic synapse
hsa04915  Estrogen signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05215  Prostate cancer
hsa05222  Small cell lung cancer
hsa05226  Gastric cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06131  Apoptosis (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
nt06227  NR signaling
nt06231  Apoptosis
nt06260  Colorectal cancer
nt06267  Small cell lung cancer
nt06270  Breast cancer
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
  Element
N00098  Intrinsic apoptotic pathway
N00100  BCL2-overexpression to intrinsic apoptotic pathway
N00262  EBV EBNA3C to intrinsic apoptotic pathway
N00286  Nuclear-initiated estrogen signaling pathway
N00451  HIV Tat to intrinsic apoptotic pathway
N00452  HIV Nef to intrinsic apoptotic pathway
N00453  HIV Vpr to intrinsic apoptotic pathway
N00474  EBV BHRF1 to intrinsic apoptotic pathway
N00475  EBV BHRF1 to intrinsic apoptotic pathway
N00478  EBV BARF1 to intrinsic apoptotic pathway
N00585  HSV US3 to intrinsic apoptotic pathway
Disease
H00005  Chronic lymphocytic leukemia
H00013  Small cell lung cancer
H00028  Choriocarcinoma
H00030  Cervical cancer
H00041  Kaposi sarcoma
H00054  Nasopharyngeal cancer
H01613  Follicular lymphoma
Drug target
Obatoclax mesylate: D08954
Oblimersen (DG00728): D05216 D08290
Venetoclax: D10679
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    596 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    596 (BCL2)
   04630 Jak-STAT signaling pathway
    596 (BCL2)
   04064 NF-kappa B signaling pathway
    596 (BCL2)
   04066 HIF-1 signaling pathway
    596 (BCL2)
   04071 Sphingolipid signaling pathway
    596 (BCL2)
   04151 PI3K-Akt signaling pathway
    596 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    596 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    596 (BCL2)
   04215 Apoptosis - multiple species
    596 (BCL2)
   04217 Necroptosis
    596 (BCL2)
   04115 p53 signaling pathway
    596 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    596 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    596 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    596 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    596 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    596 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    596 (BCL2)
   04722 Neurotrophin signaling pathway
    596 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    596 (BCL2)
   05206 MicroRNAs in cancer
    596 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    596 (BCL2)
   05226 Gastric cancer
    596 (BCL2)
   05215 Prostate cancer
    596 (BCL2)
   05222 Small cell lung cancer
    596 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    596 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    596 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    596 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    596 (BCL2)
   05131 Shigellosis
    596 (BCL2)
   05152 Tuberculosis
    596 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    596 (BCL2)
   05162 Measles
    596 (BCL2)
   05161 Hepatitis B
    596 (BCL2)
   05168 Herpes simplex virus 1 infection
    596 (BCL2)
   05169 Epstein-Barr virus infection
    596 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    596 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    596 (BCL2)
   01524 Platinum drug resistance
    596 (BCL2)
   01522 Endocrine resistance
    596 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    596 (BCL2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     596 (BCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 596
NCBI-ProteinID: NP_000624
OMIM: 151430
HGNC: 990
Ensembl: ENSG00000171791
Vega: OTTHUMG00000132791
Pharos: P10415(Tclin)
UniProt: P10415 A0A024R2B3
LinkDB All DBs
Structure
PDB: 

Position
18q21.33
AA seq 239 aa AA seqDB search
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtacgataaccgggagatagtgatgaagtacatccat
tataagctgtcgcagaggggctacgagtgggatgcgggagatgtgggcgccgcgcccccg
ggggccgcccccgcaccgggcatcttctcctcccagcccgggcacacgccccatccagcc
gcatcccgggacccggtcgccaggacctcgccgctgcagaccccggctgcccccggcgcc
gccgcggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgccaggcc
ggcgacgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctgcac
ctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttcagggac
ggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggag
agcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtac
ctgaaccggcacctgcacacctggatccaggataacggaggctgggatgcctttgtggaa
ctgtacggccccagcatgcggcctctgtttgatttctcctggctgtctctgaagactctg
ctcagtttggccctggtgggagcttgcatcaccctgggtgcctatctgggccacaagtga

KEGG   Homo sapiens (human): 9166Help
Entry
9166              CDS       T01001                                 

Gene name
EBAG9, EB9, PDAF
Definition
(RefSeq) estrogen receptor binding site associated antigen 9
  KO
K22455  estrogen receptor-binding fragment-associated gene 9 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
Network
nt06227  NR signaling
nt06270  Breast cancer
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
  Element
N00286  Nuclear-initiated estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    9166 (EBAG9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 9166
NCBI-ProteinID: NP_001265867
OMIM: 605772
HGNC: 3123
Ensembl: ENSG00000147654
Vega: OTTHUMG00000165346
Pharos: O00559(Tbio)
UniProt: O00559 A0A024R9E0
LinkDB All DBs
Position
8q23.2
AA seq 213 aa AA seqDB search
MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEW
TSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGI
PDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLAD
REKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggccatcacccagtttcggttatttaaattttgtacctgcctagcaacagtattctca
ttcctaaagagattaatatgcagatctggcagaggacggaaattaagtggagaccaaata
actttgccaactacagttgattattcatcagttcctaagcagacagatgttgaagagtgg
acttcctgggatgaagatgcacccaccagtgtaaagatcgaaggagggaatgggaatgtg
gcaacacaacaaaattctttggaacaactggaacctgactattttaaggacatgacacca
actattaggaaaactcagaaaattgttattaagaagagagaaccattgaattttggcatc
ccagatgggagcacaggtttctctagtagattagcagctacacaagatctgccttttatt
catcagtcttctgaattaggtgacttagatacctggcaggaaaataccaatgcatgggaa
gaagaagaagatgcagcctggcaagcagaagaagttctgagacagcagaaactagcagac
agagaaaagagagcagccgaacaacaaaggaagaaaatggaaaaggaagcacaacggcta
atgaagaaggaacaaaacaaaattggtgtgaaactttcataa

KEGG   Homo sapiens (human): 3880Help
Entry
3880              CDS       T01001                                 

Gene name
KRT19, CK19, K19, K1CS
Definition
(RefSeq) keratin 19
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Network
nt06227  NR signaling
nt06270  Breast cancer
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
  Element
N00286  Nuclear-initiated estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    3880 (KRT19)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3880 (KRT19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    3880 (KRT19)
   04147 Exosome [BR:hsa04147]
    3880 (KRT19)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3880 (KRT19)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3880 (KRT19)
  Exosomal proteins of other body fluids (saliva and urine)
   3880 (KRT19)
  Exosomal proteins of colorectal cancer cells
   3880 (KRT19)
  Exosomal proteins of melanoma cells
   3880 (KRT19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Prefoldin Bacillus_HBL DUF4407 TPR_MLP1_2 Spc7 FlxA T2SSM Golgin_A5
Motif
Other DBs
NCBI-GeneID: 3880
NCBI-ProteinID: NP_002267
OMIM: 148020
HGNC: 6436
Ensembl: ENSG00000171345
Vega: OTTHUMG00000133422
Pharos: P08727(Tbio)
UniProt: P08727
LinkDB All DBs
Position
17q21.2
AA seq 400 aa AA seqDB search
MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGA
YGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQG
PGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDNARLAADDFRTKFETEQALRMSVE
ADINGLRRVLDELTLARTDLEMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVEVDSA
PGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR
RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQN
QEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctacagctatcgccagtcgtcggccacgtcgtccttcggaggcctgggcggc
ggctccgtgcgttttgggccgggggtcgcctttcgcgcgcccagcattcacgggggctcc
ggcggccgcggcgtatccgtgtcctccgcccgctttgtgtcctcgtcctcctcgggggcc
tacggcggcggctacggcggcgtcctgaccgcgtccgacgggctgctggcgggcaacgag
aagctaaccatgcagaacctcaacgaccgcctggcctcctacctggacaaggtgcgcgcc
ctggaggcggccaacggcgagctagaggtgaagatccgcgactggtaccagaagcagggg
cctgggccctcccgcgactacagccactactacacgaccatccaggacctgcgggacaag
attcttggtgccaccattgagaactccaggattgtcctgcagatcgacaatgcccgtctg
gctgcagatgacttccgaaccaagtttgagacggaacaggctctgcgcatgagcgtggag
gccgacatcaacggcctgcgcagggtgctggatgagctgaccctggccaggaccgacctg
gagatgcagatcgaaggcctgaaggaagagctggcctacctgaagaagaaccatgaggag
gaaatcagtacgctgaggggccaagtgggaggccaggtcagtgtggaggtggattccgct
ccgggcaccgatctcgccaagatcctgagtgacatgcgaagccaatatgaggtcatggcc
gagcagaaccggaaggatgctgaagcctggttcaccagccggactgaagaattgaaccgg
gaggtcgctggccacacggagcagctccagatgagcaggtccgaggttactgacctgcgg
cgcacccttcagggtcttgagattgagctgcagtcacagctgagcatgaaagctgccttg
gaagacacactggcagaaacggaggcgcgctttggagcccagctggcgcatatccaggcg
ctgatcagcggtattgaagcccagctgggcgatgtgcgagctgatagtgagcggcagaat
caggagtaccagcggctcatggacatcaagtcgcggctggagcaggagattgccacctac
cgcagcctgctcgagggacaggaagatcactacaacaatttgtctgcctccaaggtcctc
tga

KEGG   Homo sapiens (human): 1509Help
Entry
1509              CDS       T01001                                 

Gene name
CTSD, CLN10, CPSD, HEL-S-130P
Definition
(RefSeq) cathepsin D
  KO
K01379  cathepsin D [EC:3.4.23.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04071  Sphingolipid signaling pathway
hsa04140  Autophagy - animal
hsa04142  Lysosome
hsa04210  Apoptosis
hsa04915  Estrogen signaling pathway
hsa05152  Tuberculosis
Network
nt06227  NR signaling
nt06270  Breast cancer
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
  Element
N00286  Nuclear-initiated estrogen signaling pathway
Disease
H00149  Neuronal ceroid lipofuscinosis
H02279  Cathepsin D deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    1509 (CTSD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    1509 (CTSD)
   04140 Autophagy - animal
    1509 (CTSD)
  09143 Cell growth and death
   04210 Apoptosis
    1509 (CTSD)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    1509 (CTSD)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    1509 (CTSD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1509 (CTSD)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1509 (CTSD)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.5  cathepsin D
     1509 (CTSD)
Peptidases and inhibitors [BR:hsa01002]
 Aspartic peptidases
  Family A1: pepsin family
   1509 (CTSD)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1509 (CTSD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp TAXi_N A1_Propeptide TAXi_C
Motif
Other DBs
NCBI-GeneID: 1509
NCBI-ProteinID: NP_001900
OMIM: 116840
HGNC: 2529
Ensembl: ENSG00000117984
Vega: OTTHUMG00000044760
Pharos: P07339(Tchem)
UniProt: P07339 V9HWI3
LinkDB All DBs
Structure
PDB: 

Position
11p15.5
AA seq 412 aa AA seqDB search
MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcagccctccagccttctgccgctcgccctctgcctgctggctgcacccgcctccgcg
ctcgtcaggatcccgctgcacaagttcacgtccatccgccggaccatgtcggaggttggg
ggctctgtggaggacctgattgccaaaggccccgtctcaaagtactcccaggcggtgcca
gccgtgaccgaggggcccattcccgaggtgctcaagaactacatggacgcccagtactac
ggggagattggcatcgggacgcccccccagtgcttcacagtcgtcttcgacacgggctcc
tccaacctgtgggtcccctccatccactgcaaactgctggacatcgcttgctggatccac
cacaagtacaacagcgacaagtccagcacctacgtgaagaatggtacctcgtttgacatc
cactatggctcgggcagcctctccgggtacctgagccaggacactgtgtcggtgccctgc
cagtcagcgtcgtcagcctctgccctgggcggtgtcaaagtggagaggcaggtctttggg
gaggccaccaagcagccaggcatcaccttcatcgcagccaagttcgatggcatcctgggc
atggcctacccccgcatctccgtcaacaacgtgctgcccgtcttcgacaacctgatgcag
cagaagctggtggaccagaacatcttctccttctacctgagcagggacccagatgcgcag
cctgggggtgagctgatgctgggtggcacagactccaagtattacaagggttctctgtcc
tacctgaatgtcacccgcaaggcctactggcaggtccacctggaccaggtggaggtggcc
agcgggctgaccctgtgcaaggagggctgtgaggccattgtggacacaggcacttccctc
atggtgggcccggtggatgaggtgcgcgagctgcagaaggccatcggggccgtgccgctg
attcagggcgagtacatgatcccctgtgagaaggtgtccaccctgcccgcgatcacactg
aagctgggaggcaaaggctacaagctgtccccagaggactacacgctcaaggtgtcgcag
gccgggaagaccctctgcctgagcggcttcatgggcatggacatcccgccacccagcggg
ccactctggatcctgggcgacgtcttcatcggccgctactacactgtgtttgaccgtgac
aacaacagggtgggcttcgccgaggctgcccgcctctag

KEGG   Homo sapiens (human): 7031Help
Entry
7031              CDS       T01001                                 

Gene name
TFF1, BCEI, D21S21, HP1.A, HPS2, pNR-2, pS2
Definition
(RefSeq) trefoil factor 1
  KO
K22456  trefoil factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
Network
nt06227  NR signaling
nt06270  Breast cancer
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
  Element
N00286  Nuclear-initiated estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    7031 (TFF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trefoil
Motif
Other DBs
NCBI-GeneID: 7031
NCBI-ProteinID: NP_003216
OMIM: 113710
HGNC: 11755
Ensembl: ENSG00000160182
Vega: OTTHUMG00000086799
Pharos: P04155(Tbio)
UniProt: P04155
LinkDB All DBs
Structure
PDB: 

Position
21q22.3
AA seq 84 aa AA seqDB search
MATMENKVICALVLVSMLALGTLAEAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDD
TVRGVPWCFYPNTIDVPPEEECEF
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atggccaccatggagaacaaggtgatctgcgccctggtcctggtgtccatgctggccctc
ggcaccctggccgaggcccagacagagacgtgtacagtggccccccgtgaaagacagaat
tgtggttttcctggtgtcacgccctcccagtgtgcaaataagggctgctgtttcgacgac
accgttcgtggggtcccctggtgcttctatcctaataccatcgacgtccctccagaagag
gagtgtgaattttag

KEGG   Homo sapiens (human): 5241Help
Entry
5241              CDS       T01001                                 

Gene name
PGR, NR3C3, PR
Definition
(RefSeq) progesterone receptor
  KO
K08556  progesterone receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa05224  Breast cancer
Network
nt06227  NR signaling
nt06270  Breast cancer
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
  Element
N00286  Nuclear-initiated estrogen signaling pathway
Drug target
Aglepristone: D07096
Allylestrenol: D01374
Altrenogest: D02840
Amadinone acetate: D02881
Asoprisnil: D02996
Chlormadinone (DG00469): D01299 D07670
Danazol: D00289
Demegestone: D07223
Desogestrel: D02367
Dienogest: D03799
Drospirenone: D03917
Dydrogesterone: D01217
Ethylestrenol: D01414
Etonogestrel: D04104
Etynodiol (DG00470): D01294 D07939
Flugestone: D07968
Gestaclone: D04315
Gestodene: D04316
Gestonorone: D01159
Hydroxyprogesterone (DG00467): D00949 D08052 D08053
Levonorgestrel: D00950
Lonaprisan: D10016
Lynestrenol: D01580
Medrogestone: D04885
Medroxyprogesterone (DG00458): D00951 D08166
Megestrol (DG00457): D00952 D08167
Methynodiol diacetate: D05003
Metogest: D05009
Mifepristone: D00585
Nomegestrol (DG00468): D07222 D08281
Norelgestromin: D05205
Norethisterone (DG00456): D00182 D00953 D08285
Norethynodrel: D05207
Norgestimate: D05209
Norgestrel: D00954
Norgestrienone: D07220
Onapristone: D09571
Oxogestone phenpropionate: D05308
Progesterone: D00066
Proligestone: D08429
Promegestone: D08431
Quingestanol: D05679
Quingestrone: D05680
Segesterone (DG02828): D10986 D10987
Tanaproget: D06003
Telapristone acetate: D09972
Tigestol: D06145
Tosagestin: D06197
Trimegestone: D06235
Ulipristal (DG00459): D09567 D09687
Vilaprisan: D11181
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5241 (PGR)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    5241 (PGR)
   04914 Progesterone-mediated oocyte maturation
    5241 (PGR)
 09160 Human Diseases
  09162 Cancer: specific types
   05224 Breast cancer
    5241 (PGR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5241 (PGR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    5241 (PGR)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen-like
    5241 (PGR)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   5241 (PGR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Prog_receptor Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 5241
NCBI-ProteinID: NP_000917
OMIM: 607311
HGNC: 8910
Ensembl: ENSG00000082175
Vega: OTTHUMG00000167531
Pharos: P06401(Tclin)
UniProt: P06401
LinkDB All DBs
Structure
PDB: 

Position
11q22.1
AA seq 933 aa AA seqDB search
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLF
PRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLA
PSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAA
AHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGK
PRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTV
MDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPD
CAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLG
PPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPC
KAPGASGCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPP
YLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHN
YLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQPV
GVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQ
LGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAP
DLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQ
FEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRA
LSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgactgagctgaaggcaaagggtccccgggctccccacgtggcgggcggcccgccctcc
cccgaggtcggatccccactgctgtgtcgcccagccgcaggtccgttcccggggagccag
acctcggacaccttgcctgaagtttcggccatacctatctccctggacgggctactcttc
cctcggccctgccagggacaggacccctccgacgaaaagacgcaggaccagcagtcgctg
tcggacgtggagggcgcatattccagagctgaagctacaaggggtgctggaggcagcagt
tctagtcccccagaaaaggacagcggactgctggacagtgtcttggacactctgttggcg
ccctcaggtcccgggcagagccaacccagccctcccgcctgcgaggtcaccagctcttgg
tgcctgtttggccccgaacttcccgaagatccaccggctgcccccgccacccagcgggtg
ttgtccccgctcatgagccggtccgggtgcaaggttggagacagctccgggacggcagct
gcccataaagtgctgccccggggcctgtcaccagcccggcagctgctgctcccggcctct
gagagccctcactggtccggggccccagtgaagccgtctccgcaggccgctgcggtggag
gttgaggaggaggatggctctgagtccgaggagtctgcgggtccgcttctgaagggcaaa
cctcgggctctgggtggcgcggcggctggaggaggagccgcggctgtcccgccgggggcg
gcagcaggaggcgtcgccctggtccccaaggaagattcccgcttctcagcgcccagggtc
gccctggtggagcaggacgcgccgatggcgcccgggcgctccccgctggccaccacggtg
atggatttcatccacgtgcctatcctgcctctcaatcacgccttattggcagcccgcact
cggcagctgctggaagacgaaagttacgacggcggggccggggctgccagcgcctttgcc
ccgccgcggagttcaccctgtgcctcgtccaccccggtcgctgtaggcgacttccccgac
tgcgcgtacccgcccgacgccgagcccaaggacgacgcgtaccctctctatagcgacttc
cagccgcccgctctaaagataaaggaggaggaggaaggcgcggaggcctccgcgcgctcc
ccgcgttcctaccttgtggccggtgccaaccccgcagccttcccggatttcccgttgggg
ccaccgcccccgctgccgccgcgagcgaccccatccagacccggggaagcggcggtgacg
gccgcacccgccagtgcctcagtctcgtctgcgtcctcctcggggtcgaccctggagtgc
atcctgtacaaagcggagggcgcgccgccccagcagggcccgttcgcgccgccgccctgc
aaggcgccgggcgcgagcggctgcctgctcccgcgggacggcctgccctccacctccgcc
tctgccgccgccgccggggcggcccccgcgctctaccctgcactcggcctcaacgggctc
ccgcagctcggctaccaggccgccgtgctcaaggagggcctgccgcaggtctacccgccc
tatctcaactacctgaggccggattcagaagccagccagagcccacaatacagcttcgag
tcattacctcagaagatttgtttaatctgtggggatgaagcatcaggctgtcattatggt
gtccttacctgtgggagctgtaaggtcttctttaagagggcaatggaagggcagcacaac
tacttatgtgctggaagaaatgactgcatcgttgataaaatccgcagaaaaaactgccca
gcatgtcgccttagaaagtgctgtcaggctggcatggtccttggaggtcgaaaatttaaa
aagttcaataaagtcagagttgtgagagcactggatgctgttgctctcccacagccagtg
ggcgttccaaatgaaagccaagccctaagccagagattcactttttcaccaggtcaagac
atacagttgattccaccactgatcaacctgttaatgagcattgaaccagatgtgatctat
gcaggacatgacaacacaaaacctgacacctccagttctttgctgacaagtcttaatcaa
ctaggcgagaggcaacttctttcagtagtcaagtggtctaaatcattgccaggttttcga
aacttacatattgatgaccagataactctcattcagtattcttggatgagcttaatggtg
tttggtctaggatggagatcctacaaacacgtcagtgggcagatgctgtattttgcacct
gatctaatactaaatgaacagcggatgaaagaatcatcattctattcattatgccttacc
atgtggcagatcccacaggagtttgtcaagcttcaagttagccaagaagagttcctctgt
atgaaagtattgttacttcttaatacaattcctttggaagggctacgaagtcaaacccag
tttgaggagatgaggtcaagctacattagagagctcatcaaggcaattggtttgaggcaa
aaaggagttgtgtcgagctcacagcgtttctatcaacttacaaaacttcttgataacttg
catgatcttgtcaaacaacttcatctgtactgcttgaatacatttatccagtcccgggca
ctgagtgttgaatttccagaaatgatgtctgaagttattgctgcacaattacccaagata
ttggcagggatggtgaaaccccttctctttcataaaaagtga

DBGET integrated database retrieval system