KEGG   Homo sapiens (human): 5966Help
Entry
5966              CDS       T01001                                 

Gene name
REL, C-Rel
Definition
(RefSeq) REL proto-oncogene, NF-kB subunit
  KO
K09254  c-Rel proto-oncogene protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
Network
nt06240  Transcription
  Element
N00123  Amplified REL to transcription
Disease
H00007  Hodgkin lymphoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5966 (REL)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    5966 (REL)
   05203 Viral carcinogenesis
    5966 (REL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5966 (REL)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    5966 (REL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer
Motif
Other DBs
NCBI-GeneID: 5966
NCBI-ProteinID: NP_002899
OMIM: 164910
HGNC: 9954
Ensembl: ENSG00000162924
Vega: OTTHUMG00000129418
Pharos: Q04864(Tbio)
UniProt: Q04864
LinkDB All DBs
Position
2p16.1
AA seq 619 aa AA seqDB search
MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGK
VRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAII
TRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQV
AIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLF
QKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYF
KKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTP
RSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSA
DLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMS
SSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGI
GSMQNEQLSDSFPYEFFQV
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggcctccggtgcgtataacccgtatatagagataattgaacaacccaggcagagggga
atgcgttttagatacaaatgtgaagggcgatcagcaggcagcattccaggggagcacagc
acagacaacaaccgaacatacccttctatccagattatgaactattatggaaaaggaaaa
gtgagaattacattagtaacaaagaatgacccatataaacctcatcctcatgatttagtt
ggaaaagactgcagagacggctactatgaagcagaatttggacaagaacgcagacctttg
tttttccaaaatttgggtattcgatgtgtgaagaaaaaagaagtaaaagaagctattatt
acaagaataaaggcaggaatcaatccattcaatgtccctgaaaaacagctgaatgatatt
gaagattgtgacctcaatgtggtgagactgtgttttcaagtttttctccctgatgaacat
ggtaatttgacgactgctcttcctcctgttgtctcgaacccaatttatgacaaccgtgct
ccaaatactgcagaattaaggatttgtcgtgtaaacaagaattgtggaagtgtcagagga
ggagatgaaatatttctactttgtgacaaagttcagaaagatgacatagaagttcgtttt
gtgttgaacgattgggaagcaaaaggcatcttttcacaagctgatgtacaccgtcaagta
gccattgttttcaaaactccaccatattgcaaagctatcacagaacccgtaacagtaaaa
atgcagttgcggagaccttctgaccaggaagttagtgaatctatggattttagatatctg
ccagatgaaaaagatacttacggcaataaagcaaagaaacaaaagacaactctgcttttc
cagaaactgtgccaggatcacgtagaaacagggtttcgccatgttgaccaggatggtctt
gaactcctgacatcaggtgatccacccaccttggcctcccaaagtgctgggattacagtt
aattttcctgagagaccaagacctggtctcctcggttcaattggagaaggaagatacttc
aaaaaagaaccaaacttgttttctcatgatgcagttgtgagagaaatgcctacaggggtt
tcaagtcaagcagaatcctactatccctcacctgggcccatctcaagtggattgtcacat
catgcctcaatggcacctctgccttcttcaagctggtcatcagtggcccaccccacccca
cgctcaggcaatacaaacccactgagtagtttttcaacaaggacacttccttctaattcg
caaggtatcccaccattcctgagaatacctgttgggaatgatttaaatgcttctaatgct
tgcatttacaacaatgccgatgacatagtcggaatggaagcgtcatccatgccatcagca
gatttatatggtatttctgatcccaacatgctgtctaattgttctgtgaatatgatgaca
accagcagtgacagcatgggagagactgataatccaagacttctgagcatgaatcttgaa
aacccctcatgtaattcagtgttagacccaagagacttgagacagctccatcagatgtcc
tcttccagtatgtcagcaggcgccaattccaatactactgtttttgtttcacaatcagat
gcatttgagggatctgacttcagttgtgcagataacagcatgataaatgagtcgggacca
tcaaacagtactaatccaaacagtcatggttttgttcaagatagtcagtattcaggtatt
ggcagtatgcaaaatgagcaattgagtgactcctttccatatgaattttttcaagtataa

DBGET integrated database retrieval system