KEGG   Homo sapiens (human): 597Help
Entry
597               CDS       T01001                                 

Gene name
BCL2A1, ACC-1, ACC-2, ACC1, ACC2, BCL2L5, BFL1, GRS, HBPA1
Definition
(RefSeq) BCL2 related protein A1
  KO
K02162  hematopoietic Bcl-2-related protein A1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04210  Apoptosis
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00113  PML-RARA fusion to transcriptional repression
N00123  Amplified REL to transcription
Drug target
Navitoclax: D09935
Navitoclax dihydrochloride: D09936
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    597 (BCL2A1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    597 (BCL2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    597 (BCL2A1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    597 (BCL2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 DDE_Tnp_1_assoc CCDC24
Motif
Other DBs
NCBI-GeneID: 597
NCBI-ProteinID: NP_004040
OMIM: 601056
HGNC: 991
Ensembl: ENSG00000140379
Vega: OTTHUMG00000144173
Pharos: Q16548(Tchem)
UniProt: Q16548
LinkDB All DBs
Structure
PDB: 

Position
15q25.1
AA seq 175 aa AA seqDB search
MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgacagactgtgaatttggatatatttacaggctggctcaggactatctgcagtgcgtc
ctacagataccacaacctggatcaggtccaagcaaaacgtccagagtgctacaaaatgtt
gcgttctcagtccaaaaagaagtggaaaagaatctgaagtcatgcttggacaatgttaat
gttgtgtccgtagacactgccagaacactattcaaccaagtgatggaaaaggagtttgaa
gacggcatcattaactggggaagaattgtaaccatatttgcatttgaaggtattctcatc
aagaaacttctacgacagcaaattgccccggatgtggatacctataaggagatttcatat
tttgttgcggagttcataatgaataacacaggagaatggataaggcaaaacggaggctgg
gaaaatggctttgtaaagaagtttgaacctaaatctggctggatgacttttctagaagtt
acaggaaagatctgtgaaatgctatctctcctgaagcaatactgttga

DBGET integrated database retrieval system