KEGG   Homo sapiens (human): 5979Help
Entry
5979              CDS       T01001                                 

Gene name
RET, CDHF12, CDHR16, HSCR1, MEN2A, MEN2B, MTC1, PTC, RET-ELE1
Definition
(RefSeq) ret proto-oncogene
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05216  Thyroid cancer
hsa05230  Central carbon metabolism in cancer
Network
nt06210  ERK signaling
nt06274  Thyroid cancer
  Element
N00008  RET-PTC fusion kinase to RAS-ERK signaling pathway
Disease
H00032  Thyroid cancer
H00247  Multiple endocrine neoplasia syndrome
H00910  Hirschsprung disease
H00916  Congenital central hypoventilation syndrome
H01510  Malignant paraganglioma
H01592  Medullary thyroid cancer
Drug target
Cabozantinib (DG01670): D10062 D10095
Lenvatinib (DG01362): D09919 D09920
Motesanib (DG01262): D06678 D08947
Regorafenib (DG00720): D10137 D10138
Sorafenib (DG00713): D06272 D08524
Sunitinib (DG00712): D06402 D08552
Vandetanib: D06407
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5979 (RET)
   05230 Central carbon metabolism in cancer
    5979 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    5979 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5979 (RET)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     5979 (RET)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  RET family
   5979 (RET)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr RET_CLD1 RET_CLD3 RET_CLD4 Pkinase Cadherin RIO1 Haspin_kinase Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 5979
NCBI-ProteinID: NP_066124
OMIM: 164761
HGNC: 9967
Ensembl: ENSG00000165731
Vega: OTTHUMG00000018024
Pharos: P07949(Tclin)
UniProt: P07949 A0A024R7T2
LinkDB All DBs
Structure
PDB: 

Position
10q11.21
AA seq 1114 aa AA seqDB search
MAKATSGAAGLRLLLLLLLPLLGKVALGLYFSRDAYWEKLYVDQAAGTPLLYVHALRDAP
EEVPSFRLGQHLYGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEKLSVRNRGFPLLT
VYLKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRIRENR
PPGTFHQFRLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTRWALDREQREKYELV
AVCTVHAGAREEVVMVPFPVTVYDEDDSAPTFPAGVDTASAVVEFKRKEDTVVATLRVFD
ADVVPASGELVRRYTSTLLPGDTWAQQTFRVEHWPNETSVQANGSFVRATVHDYRLVLNR
NLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFA
QIGKVCVENCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRPKCAE
LHYMVVATDQQTSRQAQAQLLVTVEGSYVAEEAGCPLSCAVSKRRLECEECGGLGSPTGR
CEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDINICPQDCLRGSIVGGHEPGEPR
GIKAGYGTCNCFPEEEKCFCEPEDIQDPLCDELCRTVIAAAVLFSFIVSVLLSAFCIHCY
HKFAHKPPISSAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKILEDPKWEFP
RKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLK
QVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDH
PDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVY
EEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERL
FNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAA
STPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGMSDPNWPGESPVPLTRA
DGTNTGFPRYPNDSVYANWMLSPSAAKLMDTFDS
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcgacgtccggtgccgcggggctgcgtctgctgttgctgctgctgctgccg
ctgctaggcaaagtggcattgggcctctacttctcgagggatgcttactgggagaagctg
tatgtggaccaggcagccggcacgcccttgctgtacgtccatgccctgcgggacgcccct
gaggaggtgcccagcttccgcctgggccagcatctctacggcacgtaccgcacacggctg
catgagaacaactggatctgcatccaggaggacaccggcctcctctaccttaaccggagc
ctggaccatagctcctgggagaagctcagtgtccgcaaccgcggctttcccctgctcacc
gtctacctcaaggtcttcctgtcacccacatcccttcgtgagggcgagtgccagtggcca
ggctgtgcccgcgtatacttctccttcttcaacacctcctttccagcctgcagctccctc
aagccccgggagctctgcttcccagagacaaggccctccttccgcattcgggagaaccga
cccccaggcaccttccaccagttccgcctgctgcctgtgcagttcttgtgccccaacatc
agcgtggcctacaggctcctggagggtgagggtctgcccttccgctgcgccccggacagc
ctggaggtgagcacgcgctgggccctggaccgcgagcagcgggagaagtacgagctggtg
gccgtgtgcaccgtgcacgccggcgcgcgcgaggaggtggtgatggtgcccttcccggtg
accgtgtacgacgaggacgactcggcgcccaccttccccgcgggcgtcgacaccgccagc
gccgtggtggagttcaagcggaaggaggacaccgtggtggccacgctgcgtgtcttcgat
gcagacgtggtacctgcatcaggggagctggtgaggcggtacacaagcacgctgctcccc
ggggacacctgggcccagcagaccttccgggtggaacactggcccaacgagacctcggtc
caggccaacggcagcttcgtgcgggcgaccgtacatgactataggctggttctcaaccgg
aacctctccatctcggagaaccgcaccatgcagctggcggtgctggtcaatgactcagac
ttccagggcccaggagcgggcgtcctcttgctccacttcaacgtgtcggtgctgccggtc
agcctgcacctgcccagtacctactccctctccgtgagcaggagggctcgccgatttgcc
cagatcgggaaagtctgtgtggaaaactgccaggcattcagtggcatcaacgtccagtac
aagctgcattcctctggtgccaactgcagcacgctaggggtggtcacctcagccgaggac
acctcggggatcctgtttgtgaatgacaccaaggccctgcggcggcccaagtgtgccgaa
cttcactacatggtggtggccaccgaccagcagacctctaggcaggcccaggcccagctg
cttgtaacagtggaggggtcatatgtggccgaggaggcgggctgccccctgtcctgtgca
gtcagcaagagacggctggagtgtgaggagtgtggcggcctgggctccccaacaggcagg
tgtgagtggaggcaaggagatggcaaagggatcaccaggaacttctccacctgctctccc
agcaccaagacctgccccgacggccactgcgatgttgtggagacccaagacatcaacatt
tgccctcaggactgcctccggggcagcattgttgggggacacgagcctggggagccccgg
gggattaaagctggctatggcacctgcaactgcttccctgaggaggagaagtgcttctgc
gagcccgaagacatccaggatccactgtgcgacgagctgtgccgcacggtgatcgcagcc
gctgtcctcttctccttcatcgtctcggtgctgctgtctgccttctgcatccactgctac
cacaagtttgcccacaagccacccatctcctcagctgagatgaccttccggaggcccgcc
caggccttcccggtcagctactcctcttccggtgcccgccggccctcgctggactccatg
gagaaccaggtctccgtggatgccttcaagatcctggaggatccaaagtgggaattccct
cggaagaacttggttcttggaaaaactctaggagaaggcgaatttggaaaagtggtcaag
gcaacggccttccatctgaaaggcagagcagggtacaccacggtggccgtgaagatgctg
aaagagaacgcctccccgagtgagctgcgagacctgctgtcagagttcaacgtcctgaag
caggtcaaccacccacatgtcatcaaattgtatggggcctgcagccaggatggcccgctc
ctcctcatcgtggagtacgccaaatacggctccctgcggggcttcctccgcgagagccgc
aaagtggggcctggctacctgggcagtggaggcagccgcaactccagctccctggaccac
ccggatgagcgggccctcaccatgggcgacctcatctcatttgcctggcagatctcacag
gggatgcagtatctggccgagatgaagctcgttcatcgggacttggcagccagaaacatc
ctggtagctgaggggcggaagatgaagatttcggatttcggcttgtcccgagatgtttat
gaagaggattcctacgtgaagaggagccagggtcggattccagttaaatggatggcaatt
gaatccctttttgatcatatctacaccacgcaaagtgatgtatggtcttttggtgtcctg
ctgtgggagatcgtgaccctagggggaaacccctatcctgggattcctcctgagcggctc
ttcaaccttctgaagaccggccaccggatggagaggccagacaactgcagcgaggagatg
taccgcctgatgctgcaatgctggaagcaggagccggacaaaaggccggtgtttgcggac
atcagcaaagacctggagaagatgatggttaagaggagagactacttggaccttgcggcg
tccactccatctgactccctgatttatgacgacggcctctcagaggaggagacaccgctg
gtggactgtaataatgcccccctccctcgagccctcccttccacatggattgaaaacaaa
ctctatggcatgtcagacccgaactggcctggagagagtcctgtaccactcacgagagct
gatggcactaacactgggtttccaagatatccaaatgatagtgtatatgctaactggatg
ctttcaccctcagcggcaaaattaatggacacgtttgatagttaa

KEGG   Homo sapiens (human): 8030Help
Entry
8030              CDS       T01001                                 

Gene name
CCDC6, D10S170, H4, PTC, TPC, TST1
Definition
(RefSeq) coiled-coil domain containing 6
  KO
K09288  coiled-coil domain-containing protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05216  Thyroid cancer
Disease
H00032  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8030 (CCDC6)
  09162 Cancer: specific types
   05216 Thyroid cancer
    8030 (CCDC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2046
Motif
Other DBs
NCBI-GeneID: 8030
NCBI-ProteinID: NP_005427
OMIM: 601985
HGNC: 18782
Ensembl: ENSG00000108091
Vega: OTTHUMG00000018284
Pharos: Q16204(Tbio)
UniProt: Q16204 Q05CP8
LinkDB All DBs
Position
10q21.2
AA seq 474 aa AA seqDB search
MADSASESDTDGAGGNSSSSAAMQSSCSSTSGGGGGGGGGGGGGKSGGIVISPFRLEELT
NRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKI
QALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKK
LENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVS
APPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREE
NLRLQRKLQREMERREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTVSSPIPYTPSP
SSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGITRPSPRRSNSP
DKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSAATSQPTPSQHSAHPSSQP
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcggacagcgccagcgagagcgacacggacggggcggggggcaacagcagcagctcg
gccgccatgcagtcgtcctgctcgtcgacctcgggcggcggcggtggcggcgggggaggc
ggcggcggtgggaagtcggggggcattgtcatctcgccgttccgcctggaggagctcacc
aaccgcctggcctcgctgcagcaagagaacaaggtgctgaagatagagctggagacctac
aaactgaagtgcaaggcactgcaggaggagaaccgcgacctgcgcaaagccagcgtgacc
atccaagccagggctgagcaggaagaagaattcattagtaacactttattcaagaaaatt
caggctttgcagaaggagaaagaaacccttgctgtaaattatgagaaagaagaagaattc
ctcactaatgagctctccagaaaattgatgcagttgcagcatgagaaagccgaactagaa
cagcatcttgaacaagagcaggaatttcaggtcaacaaactgatgaagaaaattaaaaaa
ctggagaatgacaccatttctaagcaacttacattagaacagttgagacgggagaagatt
gaccttgaaaatacattggaacaagaacaagaagcactagttaatcgcctctggaaaagg
atggataagcttgaagctgaaaagcgaatcctgcaggaaaaattagaccagcccgtctct
gctccaccatcgcctagagatatctccatggagattgattctccagaaaatatgatgcgt
cacatcaggtttttaaagaatgaagtggaacggctgaagaagcaactgagagctgctcag
ttacagcattcagagaaaatggcacagtatctggaggaggaacgtcacatgagagaagag
aacttgaggctccagaggaagctgcagagggagatggagagaagagaagccctctgtcga
cagctctccgagagtgagtccagcttagaaatggacgacgaaaggtattttaatgagatg
tctgcacaaggattaagacctcgcactgtgtccagcccgatcccttacacaccttctccg
agttcaagcaggcctatatcacctggtctatcatatgcaagtcacacggttggtttcacg
ccaccaacttcactgactagagctggaatgtcttattacaattccccgggtcttcacgtg
cagcacatgggaacatcccatggtatcacaaggccttcaccacggagaagcaacagtcct
gacaaattcaaacggcccacgccgcctccatctcccaacacacagaccccagtccagcca
cctccgcctccacctccgccacccatgcagcccacggtcccctcagcagccacctcgcag
cctactccttcgcaacattcggcgcacccctcctcccagccttaa

KEGG   Homo sapiens (human): 8031Help
Entry
8031              CDS       T01001                                 

Gene name
NCOA4, ARA70, ELE1, PTC3, RFG
Definition
(RefSeq) nuclear receptor coactivator 4
  KO
K09289  nuclear receptor coactivator 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04216  Ferroptosis
hsa05200  Pathways in cancer
hsa05216  Thyroid cancer
Disease
H00032  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    8031 (NCOA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8031 (NCOA4)
  09162 Cancer: specific types
   05216 Thyroid cancer
    8031 (NCOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARA70
Motif
Other DBs
NCBI-GeneID: 8031
NCBI-ProteinID: NP_001138734
OMIM: 601984
HGNC: 7671
Ensembl: ENSG00000266412
Vega: OTTHUMG00000188314
Pharos: Q13772(Tbio)
UniProt: Q13772 A0A024QZI5 Q96E88
LinkDB All DBs
Position
10q11.22
AA seq 614 aa AA seqDB search
MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHL
ECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSV
CLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLE
KRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENSQTS
SRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIEMEKVGDQELPDQDEMD
LSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEI
ENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDE
NCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPS
RIADSFQVIKNSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWV
LPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLK
VDKEKWLYRTPLQM
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaataccttccaagaccagagtggcagctccagtaatagagaaccccttttgaggtgt
agtgatgcacggagggacttggagcttgctattggtggagttctccgggctgaacagcaa
attaaagataacttgcgagaggtcaaagctcagattcacagttgcataagccgtcacctg
gaatgtcttagaagccgtgaggtatggctgtatgaacaggtggaccttatttatcagctt
aaagaggagacacttcaacagcaggctcagcagctctactcgttattgggccagttcaat
tgtcttactcatcaactggagtgtacccaaaacaaagatctagccaatcaagtctctgtg
tgcctggagagactgggcagtttgacccttaagcctgaagattcaactgtcctgctcttt
gaagctgacacaattactctgcgccagaccatcaccacatttgggtctctcaaaaccatt
caaattcctgagcacttgatggctcatgctagttcagcaaatattgggcccttcctggag
aagagaggctgtatctccatgccagagcagaagtcagcatccggtattgtagctgtccct
ttcagcgaatggctccttggaagcaaacctgccagtggttatcaagctccttacataccc
agcaccgacccccaggactggcttacccaaaagcagaccttggagaacagtcagacttct
tccagagcctgcaatttcttcaataatgtcgggggaaacctaaagggcttagaaaactgg
ctcctcaagagtgaaaaatcaagttatcaaaagtgtaacagccattccactactagttct
ttctccattgaaatggaaaaggttggagatcaagagcttcctgatcaagatgagatggac
ctatcagattggctagtgactccccaggaatcccataagctgcggaagcctgagaatggc
agtcgtgaaaccagtgagaagtttaagctcttattccagtcctataatgtgaatgattgg
cttgtcaagactgactcctgtaccaactgtcagggaaaccagcccaaaggtgtggagatt
gaaaacctgggcaatctgaagtgcctgaatgaccacttggaggccaagaaaccattgtcc
acccccagcatggttacagaggattggcttgtccagaaccatcaggacccatgtaaggta
gaggaggtgtgcagagccaatgagccctgcacaagctttgcagagtgtgtgtgtgatgag
aattgtgagaaggaggctctgtataagtggcttctgaagaaagaaggaaaggataaaaat
gggatgcctgtggaacccaaacctgagcctgagaagcataaagattccctgaatatgtgg
ctctgtcctagaaaagaagtaatagaacaaactaaagcaccaaaggcaatgactccttct
agaattgctgattccttccaagtcataaagaacagccccttgtcggagtggcttatcagg
cccccatacaaagaaggaagtcccaaggaagtgcctggtactgaagacagagctggcaaa
cagaagtttaaaagccccatgaatacttcctggtgttcctttaacacagctgactgggtc
ctgccaggaaagaagatgggcaacctcagccagttatcttctggagaagacaagtggctg
cttcgaaagaaggcccaggaagtattacttaattcacctctacaggaggaacataacttc
cccccagaccattatggcctccctgcagtttgtgatctctttgcctgtatgcagcttaaa
gttgataaagagaagtggttatatcgaactcctctacagatgtga

DBGET integrated database retrieval system