KEGG   Homo sapiens (human): 5981
Entry
5981              CDS       T01001                                 

Gene name
RFC1, A1, CANVAS, MHCBFB, PO-GA, RECC1, RFC, RFC140
Definition
(RefSeq) replication factor C subunit 1
  KO
K10754  replication factor C subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
Disease
H02366  Cerebellar ataxia, neuropathy, and vestibular areflexia syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    5981 (RFC1)
   03420 Nucleotide excision repair
    5981 (RFC1)
   03430 Mismatch repair
    5981 (RFC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5981 (RFC1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5981 (RFC1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    5981 (RFC1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     5981 (RFC1)
SSDB
Motif
Pfam: RFC1 BRCT AAA PTCB-BRCT Rad17 RuvB_N AAA_5 AAA_16 AAA_22 AAA_33 AAA_14 BRCT_2 AAA_18 AAA_17 RNA_helicase NTPase_1 AAA_7
Other DBs
NCBI-GeneID: 5981
NCBI-ProteinID: NP_001191676
OMIM: 102579
HGNC: 9969
Ensembl: ENSG00000035928
Vega: OTTHUMG00000099363
Pharos: P35251(Tbio)
UniProt: P35251
LinkDB
Structure
PDB: 
2K7F 2K6G 2EBU

Position
4p14
AA seq 1148 aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPS
KKKRIIYDSDSESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISETDEEDDFMCKK
AASKSKENGRSTNSHLGTSNMKKNEENTKTKNKPLSPIKLTPTSVLDYFGTGSVQRSNKK
MVASKRKELSQNTDESGLNDEAIAKQLQLDEDAELERQLHEDEEFARTLAMLDEEPKTKK
ARKDTEAGETFSSVQANLSKAEKHKYPHKVKTAQVSDERKSYSPRKQSKYESSKESQQHS
KSSADKIGEVSSPKASSKLAIMKRKEESSYKEIEPVASKRKENAIKLKGETKTPKKTKSS
PAKKESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLIFVITGVLES
IERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIR
TMPGKKSKYEIAVETEMKKESKLERTPQKNVQGKRKISPSKKESESKKSRPTSKRDSLAK
TIKKETDVFWKSLDFKEQVAEETSGDSKARNLADDSSENKVENLLWVDKYKPTSLKTIIG
QQGDQSCANKLLRWLRNWQKSSSEDKKHAAKFGKFSGKDDGSSFKAALLSGPPGVGKTTT
ASLVCQELGYSYVELNASDTRSKSSLKAIVAESLNNTSIKGFYSNGAASSVSTKHALIMD
EVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQI
KGAMMSIAFKEGLKIPPPAMNEIILGANQDIRQVLHNLSMWCARSKALTYDQAKADSHRA
KKDIKMGPFDVARKVFAAGEETAHMSLVDKSDLFFHDYSIAPLFVQENYIHVKPVAAGGD
MKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLPAQAIYASVLPGELMRGYMTQFPTFP
SWLGKHSSTGKHDRIVQDLALHMSLRTYSSKRTVNMDYLSLLRDALVQPLTSQGVDGVQD
VVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAI
KASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAIETDAMIKKKTKSSKPSKPEKDKEPRK
GKGKSSKK
NT seq 3447 nt   +upstreamnt  +downstreamnt
atggacattcggaaattctttggagtaataccaagtggaaagaaacttgtaagtgaaaca
gtaaagaagaatgagaaaacaaagtctgatgaagaaactttaaaagcaaagaaaggaata
aaggaaatcaaggtaaatagctcccgtaaagaggatgacttcaaacaaaagcaaccaagc
aagaaaaagaggatcatctatgattcagattcagagtcagaggagacgttgcaggtaaaa
aatgccaaaaagccaccagaaaaactgccagtatcttctaaacctggtaaaatttcacgg
caggatcctgttacatacatttcagaaacagatgaagaagatgactttatgtgtaagaag
gcggcctctaaatcaaaagagaatggaagatctacaaatagtcatcttggaacatcaaac
atgaaaaagaatgaagaaaacactaagaccaagaataagcctttatcaccaataaaactt
acacccacatcagtacttgattattttggaactggaagtgtccaaagatctaataagaag
atggtggcaagcaaaagaaaagagctttcacaaaatacagatgagtctggattaaatgat
gaagccatcgccaagcaattacagcttgatgaagatgcggagctggagaggcagttgcat
gaagatgaagagtttgccagaacattagccatgttggatgaagaacccaagaccaaaaag
gctcgaaaggacacagaagcgggagaaacgttttcatctgtccaagccaatttaagtaaa
gcagaaaaacataaatatcctcataaagtaaaaacagcacaagtttcagatgaaagaaag
agctacagtcctaggaagcaaagtaaatatgaaagttcaaaagaatctcagcaacattcc
aagtcatcagctgacaaaataggagaagtctcttctcccaaggccagttctaagctggca
attatgaaaagaaaagaagagagctcttataaagaaatagagcctgtggcctcaaaaaga
aaagaaaatgccattaaattgaaaggagagacaaaaactcctaagaaaaccaaaagttct
ccagctaaaaaagagtctgtaagtcctgaagattctgaaaagaaacgcactaattatcaa
gcttatcgaagctacttaaatcgagaaggtcccaaggctctgggctccaaagaaatacca
aagggagctgaaaattgcttggaaggccttatatttgtaatcacaggcgtgctggagtct
attgaacgagatgaggccaagtctctaattgaacgttatgggggaaaagtaacaggaaat
gtcagcaagaaaacaaattatcttgtcatgggtcgtgatagtggacagtccaagagtgat
aaggccgcagccttggggacaaaaattattgatgaagatggcctgttgaatctgattcgg
actatgccaggcaagaaatccaagtatgaaatagcagttgaaactgagatgaagaaagag
tccaaactggagagaacaccccaaaaaaatgtccaaggaaaaagaaaaattagtccatct
aaaaaggaatcagaatctaaaaagagcaggccgacttccaaaagggacagtttggcaaag
acaataaaaaaggaaacagatgtgttttggaaaagcctggatttcaaggagcaggtggct
gaggagacaagtggtgacagcaaggctaggaatttggctgatgacagcagtgaaaacaaa
gtggaaaatttgctctgggtggataaatataagccaacctcgctcaagaccataattgga
cagcaaggtgaccagagctgtgccaacaaactcctacgctggctccgaaactggcaaaag
agttcttccgaagataaaaaacacgcagcaaagtttggtaaattttccggcaaagatgat
ggctctagttttaaagcagcgttgctgtcaggccctcctggtgttggcaaaaccaccaca
gcttccctggtgtgtcaggagttgggatacagctacgtggaactgaatgcaagtgacacc
cggagtaagagcagtttgaaggcgattgttgctgagtcactgaacaataccagcatcaaa
ggcttttattcaaatggagcagcctcttcagtaagcacgaaacatgctctcatcatggat
gaagtagatggcatggcaggcaatgaggataggggaggaattcaggaattaattggcctg
ataaaacatactaaaattcccattatttgtatgtgcaatgatagaaatcatcccaagatt
cgctctctggttcattattgttttgatcttcgttttcaaagacctcgggttgaacagatt
aagggtgctatgatgtctattgcatttaaagaaggtttaaagattccccctccagctatg
aatgaaataattttgggagccaatcaagatatcagacaggttttacataatctgagtatg
tggtgtgcacgaagtaaagcattaacctatgaccaggccaaagctgattctcacagagcc
aaaaaggatatcaaaatgggcccatttgatgttgcccggaaagtgtttgcagctggagag
gagactgctcacatgtcacttgtggacaagtcagatctcttttttcatgattattcaata
gcacccctcttcgtccaggaaaattacatacacgtgaagcctgtagcagcagggggtgac
atgaaaaagcacctgatgcttttaagcagagcagcagacagcatatgcgatggtgaccta
gtggacagccagatccggagtaagcaaaactggagtcttctgcctgcgcaggccatttat
gccagtgttcttcctggagagttgatgagggggtacatgacccagtttcccaccttccca
agctggctggggaagcactcgtctacaggcaaacatgatcgtattgttcaggacctggcc
ttgcatatgagtctcagaacttactccagcaaaaggactgtaaacatggattatctgtcg
cttctaagggatgcacttgtacagcccttgacctcacaaggagtagacggagtacaggat
gttgttgcacttatggacacatattatttgatgaaagaagactttgagaatatcatggaa
atcagcagctggggtggcaaacctagtcccttttcaaagctggatcccaaggtgaaagca
gccttcacaagagcttacaataaggaagcccaccttactccatactcacttcaagctata
aaggcatctagacacagcacaagcccatccctggattcggaatacaatgaagaattaaat
gaagatgactctcaatctgatgagaaagaccaagatgctatagaaactgatgccatgatc
aagaaaaagacaaaatcttcaaagccttcaaaaccagaaaaagataaggagcccagaaaa
ggaaaaggaaaaagttcgaagaaatga

KEGG   Homo sapiens (human): 5982
Entry
5982              CDS       T01001                                 

Gene name
RFC2, RFC40
Definition
(RefSeq) replication factor C subunit 2
  KO
K10755  replication factor C subunit 2/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    5982 (RFC2)
   03420 Nucleotide excision repair
    5982 (RFC2)
   03430 Mismatch repair
    5982 (RFC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5982 (RFC2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5982 (RFC2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5982 (RFC2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    5982 (RFC2)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     5982 (RFC2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    5982 (RFC2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     5982 (RFC2)
  Check point factors
   HRAD17(Rad24)-RFC complex
    5982 (RFC2)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 AAA_14 AAA_16 AAA_22 Mg_chelatase AAA_24 Viral_helicase1 AAA_11 Rad17 RuvB_N AAA_19 AAA_18 AAA_assoc_2 AAA_5 AAA_25 MipZ DEAD T2SSE ABC_tran AAA_30 AAA_28 NTPase_1 DUF815 AAA_23 FtsK_SpoIIIE RNA_helicase DNA_pol3_delta DUF3383
Other DBs
NCBI-GeneID: 5982
NCBI-ProteinID: NP_852136
OMIM: 600404
HGNC: 9970
Ensembl: ENSG00000049541
Vega: OTTHUMG00000023239
Pharos: P35250(Tbio)
UniProt: P35250
LinkDB
Position
7q11.23
AA seq 354 aa
MEVEAVCGGAGEVEAQDSDPAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRL
EVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASNDRGIDVVRNKI
KMFAQQKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEP
IQSRCAVLRYTKLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQGDMRQALNNLQSTF
SGFGFINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYKILAHLWHLGYSPEDIIGNIF
RVCKTFQMAEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTMAPVAS
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggaggtggaggccgtctgtggtggcgcgggcgaggtggaggcccaggactctgaccct
gcccctgccttcagcaaggcccccggcagcgccggccactacgaactgccgtgggttgaa
aaatataggccagtaaagctgaatgaaattgtcgggaatgaagacaccgtgagcaggcta
gaggtctttgcaagggaaggaaatgtgcccaacatcatcattgcgggccctccaggaacc
ggcaagaccacaagcattctgtgcttggcccgggccctgctgggcccagcactcaaagat
gccatgttggaactcaatgcttcaaatgacaggggcattgacgttgtgaggaataaaatt
aaaatgtttgctcaacaaaaagtcactcttcccaaaggccgacataagatcatcattctg
gatgaagcagacagcatgaccgacggagcccagcaagccttgaggagaaccatggaaatc
tactctaaaaccactcgcttcgcccttgcttgtaatgcttcggataagatcatcgagccc
attcagtcccgctgtgcagtcctccggtacacaaagctgaccgacgcccagatcctcacc
aggctgatgaatgttatcgagaaggagagggtaccctacactgatgacggcctagaagcc
atcatcttcacggcccagggagacatgaggcaggcgctgaacaacctgcagtccaccttc
tcaggatttggcttcattaacagtgagaacgtgttcaaggtctgtgacgagccccaccca
ctgctggtaaaggagatgatccagcactgtgtgaatgccaacattgacgaagcctacaag
attcttgctcacttgtggcatctgggctactcaccagaagatatcattggcaacatcttt
cgagtgtgtaaaactttccaaatggcagaatacctgaaactggagtttatcaaggaaatt
ggatacactcacatgaaaatagcggaaggagtgaactctcttttgcagatggcaggcctc
ctggcaaggctgtgtcagaagacaatggccccggtggccagttag

KEGG   Homo sapiens (human): 5983
Entry
5983              CDS       T01001                                 

Gene name
RFC3, RFC38
Definition
(RefSeq) replication factor C subunit 3
  KO
K10756  replication factor C subunit 3/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    5983 (RFC3)
   03420 Nucleotide excision repair
    5983 (RFC3)
   03430 Mismatch repair
    5983 (RFC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5983 (RFC3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5983 (RFC3)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5983 (RFC3)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    5983 (RFC3)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     5983 (RFC3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    5983 (RFC3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     5983 (RFC3)
  Check point factors
   HRAD17(Rad24)-RFC complex
    5983 (RFC3)
SSDB
Motif
Pfam: DNA_pol3_delta2 AAA Rad17 DNA_pol3_delta AAA_16 Rep_fac_C AAA_22 ABC_tran ATPgrasp_ST DUF2247 CHB_HEX AAA_19 AAA_5 zf-HC2
Other DBs
NCBI-GeneID: 5983
NCBI-ProteinID: NP_002906
OMIM: 600405
HGNC: 9971
Ensembl: ENSG00000133119
Vega: OTTHUMG00000016715
Pharos: P40938(Tbio)
UniProt: P40938 A0A024RDQ8
LinkDB
Position
13q13.2
AA seq 356 aa
MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELY
GVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQ
LETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCL
AVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPF
TADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELL
HNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgagcctctgggtggacaagtatcggccctgctccttgggacggctggactatcacaag
gagcaggcggcccagctgcggaacctggtgcagtgtggtgactttcctcatctgttagtg
tacggaccatcaggtgctggaaaaaagacaagaattatgtgtattctacgtgaactttat
ggtgttggagtggaaaaattgagaattgaacatcagaccatcacaactccatctaaaaaa
aaaattgaaattagcaccattgcaagtaactaccaccttgaagttaatcctagtgatgct
ggaaatagtgaccgagtagtcattcaggagatgttgaaaacagtggcacaatcacaacaa
cttgaaacaaactctcaaagggattttaaagtggtattattgacagaagttgacaaactc
accaaagatgctcagcatgccttgcgaagaaccatggaaaaatatatgtctacctgcaga
ttgatcttgtgctgcaattctacatctaaagtgatcccacctattcgtagtaggtgcttg
gcggttcgtgtgcctgctcccagcattgaagatatttgccacgtgttatctactgtgtgt
aagaaggaaggtctgaatcttccttcacaactggctcatagacttgcagagaagtcttgt
agaaatctcagaaaagccctgcttatgtgtgaagcctgcagagtgcaacaatatcctttt
actgcagatcaagaaatccctgagacagattgggaggtgtatctgagggagactgcaaat
gctattgtcagtcagcaaactccacaaaggctccttgaagttcgtggaaggctgtatgag
cttctaactcattgtattcctcctgagataataatgaagggccttctctcagaactgtta
cataattgtgatggacaactgaaaggggaggtggcacaaatggcagcttactatgagcat
cgtctacagctgggtagcaaagccatttatcacttggaagcgtttgtggccaaattcatg
gcactttataagaagttcatggaggatggattggaaggcatgatgttctga

KEGG   Homo sapiens (human): 5984
Entry
5984              CDS       T01001                                 

Gene name
RFC4, A1, RFC37
Definition
(RefSeq) replication factor C subunit 4
  KO
K10755  replication factor C subunit 2/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    5984 (RFC4)
   03420 Nucleotide excision repair
    5984 (RFC4)
   03430 Mismatch repair
    5984 (RFC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5984 (RFC4)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5984 (RFC4)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5984 (RFC4)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    5984 (RFC4)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     5984 (RFC4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    5984 (RFC4)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     5984 (RFC4)
  Check point factors
   HRAD17(Rad24)-RFC complex
    5984 (RFC4)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 AAA_16 AAA_assoc_2 DUF815 AAA_24 AAA_11 AAA_30 DNA_pol3_delta AAA_22 AAA_19 Mg_chelatase RuvB_N ResIII AAA_5 TIP49_C Viral_helicase1 AAA_23 AAA_28 AAA_7
Other DBs
NCBI-GeneID: 5984
NCBI-ProteinID: NP_002907
OMIM: 102577
HGNC: 9972
Ensembl: ENSG00000163918
Vega: OTTHUMG00000156515
Pharos: P35249(Tbio)
UniProt: P35249
LinkDB
Position
3q27.3
AA seq 363 aa
MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVA
VLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVR
EKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLIC
NYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRK
AITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEG
HAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLS
QNC
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgcaagcatttcttaaaggtacatccatcagtactaaacccccgctgaccaaggatcga
ggagtagctgccagtgcgggaagtagcggagagaacaagaaagccaaacccgttccctgg
gtggaaaaatatcgcccaaaatgtgtggatgaagttgctttccaggaagaagtggttgca
gtgctgaaaaaatctttagaaggagcagatcttcctaatctcttgttttacggaccacct
ggaactggaaaaacatccactattttggcagcagctagagaactctttgggcctgaactt
ttccgattaagagttcttgagttaaatgcatctgatgaacgtggaatacaagtagttcga
gagaaagtgaaaaattttgctcaattaactgtgtcaggaagtcgctcagatgggaagccg
tgtccgccttttaagattgtgattctggatgaagcagattctatgacctcagctgctcag
gcagctttaagacgtaccatggagaaggagtcgaaaaccacccgattctgtcttatctgt
aactatgtcagtcgaataattgaacccctgacctctagatgttcaaaattccgcttcaag
cctctgtcagataaaattcaacagcagcgattactagacattgccaagaaggaaaatgtc
aaaattagtgatgagggaatagcttatcttgttaaagtgtcagaaggagacttaagaaaa
gccattacatttcttcaaagcgctactcgattaacaggtggaaaggagatcacagagaaa
gtgattacagacattgccggggtaataccagctgagaaaattgatggagtatttgctgcc
tgtcagagtggctcttttgacaaactagaagctgtggtcaaggatttaatagatgagggt
catgcagcaactcagctcgtcaatcaactccatgatgtggttgtagaaaataacttatct
gataaacagaagtctattatcacagaaaaacttgccgaagttgacaaatgcctagcagat
ggtgctgatgaacatttgcaactcatcagcctttgtgcaactgtgatgcagcagttatct
cagaattgttaa

KEGG   Homo sapiens (human): 5985
Entry
5985              CDS       T01001                                 

Gene name
RFC5, RFC36
Definition
(RefSeq) replication factor C subunit 5
  KO
K10756  replication factor C subunit 3/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    5985 (RFC5)
   03420 Nucleotide excision repair
    5985 (RFC5)
   03430 Mismatch repair
    5985 (RFC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5985 (RFC5)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5985 (RFC5)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5985 (RFC5)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    5985 (RFC5)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     5985 (RFC5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    5985 (RFC5)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     5985 (RFC5)
  Check point factors
   HRAD17(Rad24)-RFC complex
    5985 (RFC5)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 AAA_24 AAA_16 AAA_22 AAA_11 AAA_assoc_2 RuvB_N ResIII DUF815 AAA_19 AAA_14 AAA_5 DNA_pol3_delta PhoH DEAD TIP49 TniB AAA_30 AAA_7 T2SSE ATPase_2 IstB_IS21 AAA_25 Mg_chelatase AAA_3 SNF2_N Thioredoxin_6
Other DBs
NCBI-GeneID: 5985
NCBI-ProteinID: NP_031396
OMIM: 600407
HGNC: 9973
Ensembl: ENSG00000111445
Vega: OTTHUMG00000156438
Pharos: P40937(Tbio)
UniProt: P40937
LinkDB
Position
12q24.23
AA seq 340 aa
METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINEDRLPHLLLYG
PPGTGKTSTILACAKQLYKDKEFGSMVLELNASDDRGIDIIRGPILSFASTRTIFKKGFK
LVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPE
LMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTG
HPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIH
LLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggagacctcagcactcaagcagcaggagcagcccgcggcgaccaagatcaggaacctg
ccctgggttgaaaaataccggccacagaccctgaatgatctcatttctcatcaggacatt
ctgagtaccattcagaagtttatcaatgaagaccgactgccacacttgcttctctacggt
cccccagggacaggcaagacatctaccatcctagcctgtgcgaaacagctatataaagac
aaagaatttggctccatggtcttggagctgaatgcttcagatgaccgaggaatagacatc
attcgaggaccgatcctgagctttgctagcacaaggacaatatttaagaaaggctttaag
ctagtgatcttggatgaagcagacgccatgactcaggacgcccagaatgccttgagaaga
gtaattgagaaattcacagaaaataccagattctgcctcatctgtaactatctgtcaaag
atcatccctgccttgcagtcccgctgcacgaggtttcggttcggtcccctgactcctgaa
ctcatggttccccgcctggaacatgtcgtggaagaagagaaagttgatataagtgaagat
ggaatgaaagcactagtcactctttccagtggagacatgcgtagggctctgaacattttg
cagagcaccaatatggcctttgggaaggtgacagaggagactgtctacacctgcaccggg
cacccgctcaagtcagacattgccaacatcctggactggatgttgaatcaagatttcacc
acagcctacagaaatattacagagttgaaaactctgaaggggttggcactgcatgatatc
ctgacagagatacacttgtttgtgcatagagttgactttccatcttcagttcgaatacat
ttattgaccaaaatggcagacattgagtacaggctttctgttggcaccaacgagaagatc
cagctgagctccctcattgctgcatttcaagtcaccagagacctgattgttgcagaggcc
tag

DBGET integrated database retrieval system