KEGG   Homo sapiens (human): 5990Help
Entry
5990              CDS       T01001                                 

Gene name
RFX2
Definition
(RefSeq) regulatory factor X2
  KO
K09173  regulatory factor X 1/2/3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5990 (RFX2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other basic domains
   RF-X
    5990 (RFX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RFX1_trans_act RFX_DNA_binding Pox_D5 DUF2258
Motif
Other DBs
NCBI-GeneID: 5990
NCBI-ProteinID: NP_000626
OMIM: 142765
HGNC: 9983
Ensembl: ENSG00000087903
Vega: OTTHUMG00000180711
Pharos: P48378(Tbio)
UniProt: P48378
LinkDB All DBs
Position
19p13.3
AA seq 723 aa AA seqDB search
MQNSEGGADSPASVALRPSAAAPPVPASPQRVLVQAASSNPKGAQMQPISLPRVQQVPQQ
VQPVQHVYPAQVQYVEGGDAVYTNGAIRTAYTYNPEPQMYAPSSTASYFEAPGGAQVTVA
ASSPPAVPSHSMVGITMDVGGSPIVSSAGAYLIHGGMDSTRHSLAHTSRSSPATLEMAIE
NLQKSEGITSHKSGLLNSHLQWLLDNYETAEGVSLPRSSLYNHYLRHCQEHKLDPVNAAS
FGKLIRSVFMGLRTRRLGTRGNSKYHYYGIRLKPDSPLNRLQEDTQYMAMRQQPMHQKPR
YRPAQKTDSLGDSGSHSGLHSTPEQTMAVQSQHHQQYIDVSHVFPEFPAPDLGSFLLQDG
VTLHDVKALQLVYRRHCEATVDVVMNLQFHYIEKLWLSFWNSKASSSDGPTSLPASDEDP
EGAVLPKDKLISLCQCDPILRWMRSCDHILYQALVEILIPDVLRPVPSTLTQAIRNFAKS
LEGWLTNAMSDFPQQVIQTKVGVVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSD
LNRVDFANVQEQASWVCQCEESVVQRLEQDFKLTLQQQSSLDQWASWLDSVVTQVLKQHA
GSPSFPKAARQFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMFYLVEHRVAEA
TGETPIAVMGEFNDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPNHSL
QGI
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgcagaattccgagggtggagcggattcgccagcgtccgtggctctgcgtccctcggcg
gcagccccgcctgtgccagcctccccgcagagggtgttggtccaggcagccagctccaat
cccaaaggggcccagatgcagccgatctccctccccagagttcagcaggtaccccagcag
gtgcagccggtgcagcacgtgtatcctgcccaggtgcagtacgtggaagggggagacgcc
gtctacaccaatggagccatacgaacagcctacacctacaaccccgagcctcagatgtac
gcccccagcagcacggcttcttacttcgaggccccaggcggtgcccaggtgaccgtggca
gcctcgtccccgccagcggtcccctcccacagcatggtgggcatcaccatggatgtcggg
gggagccccatcgtctccagcgcgggagcctatctcatccacggggggatggacagcacc
agacactccctggcccacacctcccgctcatcgcccgccacgcttgaaatggcgattgaa
aacctccaaaaaagcgaaggaatcacatcacacaaaagcggtttactcaacagccatctc
cagtggctgttggataattatgaaacagcggaaggtgtgagtctccccagaagttctctt
tacaaccactaccttcggcactgccaggagcacaagctagacccagtgaacgccgcctcc
ttcgggaaactgatccgttctgtgtttatggggctgagaacgcggcggctgggcaccagg
ggcaactcgaagtaccattactatgggattcgtctgaagccggactcaccactgaaccgg
ctgcaggaggacacgcagtacatggccatgcggcagcagcccatgcaccagaagcccagg
taccggccagcccagaagacggacagcctcggggacagcggctcccacagcggcctgcac
agcactccggaacagaccatggccgtgcagagccagcaccaccagcagtacatagatgtc
tcccacgtcttccccgagttcccagcgcccgacctgggcagcttcctgctgcaggacggc
gtcacactgcacgacgtcaaggccctgcagctggtgtacagacggcactgcgaggcaact
gtagatgtggtgatgaacctccagttccactacatcgagaagctgtggctctccttctgg
aactctaaggcctcctccagcgacggccccacctctcttcctgccagtgacgaagacccc
gagggcgccgtcctgcccaaggacaagcttatctccctgtgtcagtgcgaccccatcctc
aggtggatgaggagctgcgaccacatcctctaccaggcgctggtggagattctcatcccc
gacgtgctgaggccggtccccagtaccttgacacaggccatccgtaactttgccaagagc
ttggaaggctggttgacaaatgccatgagtgacttcccacaacaggtcatccagaccaag
gtgggcgtcgtcagtgccttcgcccagacgctgcggcgctacacgtccctcaaccacctg
gcgcaggcggcccgggcggtgctgcagaacacgtcccagatcaaccagatgctcagcgac
ctcaaccgcgtggactttgccaacgtgcaggagcaggcctcgtgggtgtgccagtgcgag
gagagtgtggtgcagcggctggagcaggatttcaagctgaccctgcagcagcagagctcc
ctggaccagtgggccagctggctggacagtgtggtcacccaggtcctgaagcagcatgcc
ggcagccccagcttccccaaggccgcccggcagttcttgctgaaatggtccttttacagc
tccatggtgatccgggacctgaccctgcgcagcgctgccagcttcggctccttccacctc
atccgcctgctctacgacgagtacatgttctacctggtggagcaccgcgtcgcggaggcc
accggagagacgccgatcgctgtgatgggagagttcaacgatctcgcctctctgtcgctg
acgctgctcgacaaagatgacatgggcgatgagcagcgtggcagcgaggcgggcccagac
gcccgcagcctgggtgagcccctggtaaagcgggagcgcagtgaccccaaccactccctg
cagggcatctag

DBGET integrated database retrieval system