KEGG   Homo sapiens (human): 6009Help
Entry
6009              CDS       T01001                                 

Gene name
RHEB, RHEB2
Definition
(RefSeq) Ras homolog, mTORC1 binding
  KO
K07208  Ras homolog enriched in brain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04218  Cellular senescence
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05231  Choline metabolism in cancer
Network
nt06114  PI3K signaling (virus)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00357  HPV E6 to MTOR signaling pathway
N00388  HCMV UL38 to MTOR signaling pathway
N00582  IGF-IGF1R-PI3K signaling pathway
N00583  HSV VP11/12 to PI3K signaling pathway
N00584  HSV US3 to MTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    6009 (RHEB)
   04151 PI3K-Akt signaling pathway
    6009 (RHEB)
   04152 AMPK signaling pathway
    6009 (RHEB)
   04150 mTOR signaling pathway
    6009 (RHEB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    6009 (RHEB)
  09143 Cell growth and death
   04218 Cellular senescence
    6009 (RHEB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    6009 (RHEB)
   04919 Thyroid hormone signaling pathway
    6009 (RHEB)
  09149 Aging
   04211 Longevity regulating pathway
    6009 (RHEB)
  09159 Environmental adaptation
   04714 Thermogenesis
    6009 (RHEB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    6009 (RHEB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6009 (RHEB)
   05163 Human cytomegalovirus infection
    6009 (RHEB)
   05165 Human papillomavirus infection
    6009 (RHEB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    6009 (RHEB)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ras Family
   Rheb
    6009 (RHEB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB
Motif
Other DBs
NCBI-GeneID: 6009
NCBI-ProteinID: NP_005605
OMIM: 601293
HGNC: 10011
Ensembl: ENSG00000106615
Vega: OTTHUMG00000157330
Pharos: Q15382(Tbio)
UniProt: Q15382 A0A090N900
LinkDB All DBs
Structure
PDB: 

Position
7q36.1
AA seq 184 aa AA seqDB search
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSS
CSVM
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc
tcattgacgattcaatttgttgaaggccaatttgtggactcctacgatccaaccatagaa
aacacttttacaaagttgatcacagtaaatggacaagaatatcatcttcaacttgtagac
acagccgggcaagatgaatattctatctttcctcagacatactccatagatattaatggc
tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttatccat
ggcaaattgttggatatggtggggaaagtacaaatacctattatgttggttgggaataag
aaagacctgcatatggaaagggtgatcagttatgaagaagggaaagctttggcagaatct
tggaatgcagcttttttggaatcttctgctaaagaaaatcagactgctgtggatgttttt
cgaaggataattttggaggcagaaaaaatggacggggcagcttcacaaggcaagtcttca
tgctcggtgatgtga

DBGET integrated database retrieval system