KEGG   Homo sapiens (human): 602Help
Entry
602               CDS       T01001                                 

Gene name
BCL3, BCL4, D19S37
Definition
(RefSeq) BCL3 transcription coactivator
  KO
K09258  B-cell CLL/lymphoma protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    602 (BCL3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    602 (BCL3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    602 (BCL3)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    602 (BCL3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    602 (BCL3)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Others
   602 (BCL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_3 Ank_4 Ank_5
Motif
Other DBs
NCBI-GeneID: 602
NCBI-ProteinID: NP_005169
OMIM: 109560
HGNC: 998
Ensembl: ENSG00000069399
Vega: OTTHUMG00000151517
Pharos: P20749(Tbio)
UniProt: P20749
LinkDB All DBs
Structure
PDB: 

Position
19q13.32
AA seq 454 aa AA seqDB search
MPRCPAGAMDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVVPLDPL
RGGCDLPAVPGPPHGLARPEALYYPGALLPLYPTRAMGSPFPLVNLPTPLYPMMCPMEHP
LSADIAMATRADEDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAV
ITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNY
DGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGA
NVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRG
KATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPSSSPSQSPPRDPPGFPMAPPN
FFLPSPSPPAFLPFAGVLRGPGRPVPPSPAPGGS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgccccgatgccccgcgggggccatggacgaggggcccgtggacctgcgcacccggccc
aaggccgccggactcccgggcgccgcgctgccgctccgcaagcgcccgctgcgcgcgccc
tccccggagcccgccgctccccgcggcgctgcgggccttgtcgtccccctggaccctctg
cgcggcggctgcgacctgccggcggtccccgggcccccccacggcctggcccggccggag
gcgctttactaccccggagccttactgcctttgtaccccactcgggccatgggctccccg
tttcctctggtgaacctgcctacacccctataccccatgatgtgccccatggaacacccc
ctttctgctgacatcgccatggccacccgtgcagatgaggacggagacacgcctctccat
attgctgtggtgcagggtaacctgccagctgtgcaccggctggtcaacctcttccagcag
gggggccgggagctcgacatctacaacaacctacggcagacaccgctccacctggctgtg
atcaccacattaccgtctgtggtccggctcctggtgacagctggtgccagccccatggcg
ctggaccgccatggccagacggccgctcacctggcgtgcgagcaccgcagcccgacctgc
ctgcgagccctgctggacagcgcagctccgggcacgttggacctggaggcccgcaattat
gacgggctcaccgccctgcacgtggcagtgaacaccgagtgccaagaaaccgtgcagctc
ttgctagagcgcggtgccgacatcgacgcagtggacattaagagcggccgctccccgctc
atccacgccgtggaaaacaacagccttagcatggtgcagctgctgctgcagcacggcgcc
aacgtgaacgcgcaaatgtactccggcagctccgccctgcactcagcgtccggccgcggg
ctcctcccgctggtgcgcacgctggtccgcagcggcgctgacagcagcctcaagaactgc
cacaacgacacgccgctcatggtggcgcgcagccgcagggtcatcgacatcctgaggggg
aaggccacccggcctgcttccacctcccagccagacccctcccctgaccggagcgccaac
acctcccccgagagcagcagccgcctcagctccaatggtcttctctccgcatcaccatcc
tcctcaccctcccagtctccccccagggacccccctggattccccatggctcctcccaat
ttcttccttccttccccatctccacccgccttcctgccctttgctggggtcctccgaggc
cctggccggccggtgcccccctccccagctccaggaggcagctga

DBGET integrated database retrieval system