KEGG   Homo sapiens (human): 6041
Entry
6041              CDS       T01001                                 

Gene name
RNASEL, PRCA1, RNS4
Definition
(RefSeq) ribonuclease L
  KO
K01165  ribonuclease L
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05160  Hepatitis C
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
Network
nt06137  OAS/RNase L pathway (viruses)
nt06163  Hepatitis C virus (HCV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
nt06263  Hepatocellular carcinoma
  Element
N00515  Oligoadenylate synthetase (OAS)/RNase L pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    6041 (RNASEL)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    6041 (RNASEL)
   05160 Hepatitis C
    6041 (RNASEL)
   05168 Herpes simplex virus 1 infection
    6041 (RNASEL)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3 Ribonuc_2-5A Pkinase PK_Tyr_Ser-Thr Kdo RIO1 Pkinase_fungal Endonuc-EcoRV Choline_kinase
Other DBs
NCBI-GeneID: 6041
NCBI-ProteinID: NP_066956
OMIM: 180435
HGNC: 10050
Ensembl: ENSG00000135828
Vega: OTTHUMG00000035213
Pharos: Q05823(Tchem)
UniProt: Q05823
LinkDB
Structure
PDB: 
1WDY 4OAV 4G8K 4OAU 4G8L

Position
1q25.3
AA seq 741 aa
MESRDHNNPQEGPTSSSGRRAAVEDNHLLIKAVQNEDVDLVQQLLEGGANVNFQEEEGGW
TPLHNAVQMSREDIVELLLRHGADPVLRKKNGATPFILAAIAGSVKLLKLFLSKGADVNE
CDFYGFTAFMEAAVYGKVKALKFLYKRGANVNLRRKTKEDQERLRKGGATALMDAAEKGH
VEVLKILLDEMGADVNACDNMGRNALIHALLSSDDSDVEAITHLLLDHGADVNVRGERGK
TPLILAVEKKHLGLVQRLLEQEHIEINDTDSDGKTALLLAVELKLKKIAELLCKRGASTD
CGDLVMTARRNYDHSLVKVLLSHGAKEDFHPPAEDWKPQSSHWGAALKDLHRIYRPMIGK
LKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTF
YGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCG
YTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFE
DLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVG
NESDIKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVG
DLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTH
SPNKPQCDGAGGASGLASPGC
NT seq 2226 nt   +upstreamnt  +downstreamnt
atggagagcagggatcataacaacccccaggagggacccacgtcctccagcggtagaagg
gctgcagtggaagacaatcacttgctgattaaagctgttcaaaacgaagatgttgacctg
gtccagcaattgctggaaggtggagccaatgttaatttccaggaagaggaagggggctgg
acacctctgcataacgcagtacaaatgagcagggaggacattgtggaacttctgcttcgt
catggtgctgaccctgttctgaggaagaagaatggggccacgccttttatcctcgcagcg
attgcggggagcgtgaagctgctgaaacttttcctttctaaaggagcagatgtcaatgag
tgtgatttttatggcttcacagccttcatggaagccgctgtgtatggtaaggtcaaagcc
ctaaaattcctttataagagaggagcaaatgtgaatttgaggcgaaagacaaaggaggat
caagagcggctgaggaaaggaggggccacagctctcatggacgctgctgaaaaaggacac
gtagaggtcttgaagattctccttgatgagatgggggcagatgtaaacgcctgtgacaat
atgggcagaaatgccttgatccatgctctcctgagctctgacgatagtgatgtggaggct
attacgcatctgctgctggaccatggggctgatgtcaatgtgaggggagaaagagggaag
actcccctgatcctggcagtggagaagaagcacttgggtttggtgcagaggcttctggag
caagagcacatagagattaatgacacagacagtgatggcaaaacagcactgctgcttgct
gttgaactcaaactgaagaaaatcgccgagttgctgtgcaaacgtggagccagtacagat
tgtggggatcttgttatgacagcgaggcggaattatgaccattcccttgtgaaggttctt
ctctctcatggagccaaagaagattttcaccctcctgctgaagactggaagcctcagagc
tcacactggggggcagccctgaaggatctccacagaatataccgccctatgattggcaaa
ctcaagttctttattgatgaaaaatacaaaattgctgatacttcagaaggaggcatctac
ctggggttctatgagaagcaagaagtagctgtgaagacgttctgtgagggcagcccacgt
gcacagcgggaagtctcttgtctgcaaagcagccgagagaacagtcacttggtgacattc
tatgggagtgagagccacaggggccacttgtttgtgtgtgtcaccctctgtgagcagact
ctggaagcgtgtttggatgtgcacagaggggaagatgtggaaaatgaggaagatgaattt
gcccgaaatgtcctgtcatctatatttaaggctgttcaagaactacacttgtcctgtgga
tacacccaccaggatctgcaaccacaaaacatcttaatagattctaagaaagctgctcac
ctggcagattttgataagagcatcaagtgggctggagatccacaggaagtcaagagagat
ctagaggaccttggacggctggtcctctatgtggtaaagaagggaagcatctcatttgag
gatctgaaagctcaaagtaatgaagaggtggttcaactttctccagatgaggaaactaag
gacctcattcatcgtctcttccatcctggggaacatgtgagggactgtctgagtgacctg
ctgggtcatcccttcttttggacttgggagagccgctataggacgcttcggaatgtggga
aatgaatccgacatcaaaacacgaaaatctgaaagtgagatcctcagactactgcaacct
gggccttctgaacattccaaaagttttgacaagtggacgactaagattaatgaatgtgtt
atgaaaaaaatgaataagttttatgaaaaaagaggcaatttctaccagaacactgtgggt
gatctgctaaagttcatccggaatttgggagaacacattgatgaagaaaagcataaaaag
atgaaattaaaaattggagacccttccctgtattttcagaagacatttccagatctggtg
atctatgtctacacaaaactacagaacacagaatatagaaagcatttcccccaaacccac
agtccaaacaagcctcagtgtgatggagctggtggggccagtgggttggccagccctggg
tgctga

DBGET integrated database retrieval system