KEGG   Homo sapiens (human): 60529
Entry
60529             CDS       T01001                                 

Gene name
ALX4, CRS5, FND2, PFM2
Definition
(RefSeq) ALX homeobox 4
  KO
K09451  homeobox protein aristaless-like 4
Organism
hsa  Homo sapiens (human)
Disease
H00475  Enlarged parietal foramina/cranium bifidum
H00528  Frontonasal dysplasia
H02160  Craniosynostoses
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    60529 (ALX4)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    60529 (ALX4)
SSDB
Motif
Pfam: Homeodomain OAR Homeobox_KN
Other DBs
NCBI-GeneID: 60529
NCBI-ProteinID: NP_068745
OMIM: 605420
HGNC: 450
Ensembl: ENSG00000052850
Vega: OTTHUMG00000166557
Pharos: Q9H161(Tbio)
UniProt: Q9H161
LinkDB
Structure
PDB: 
2M0C

Position
11p11.2
AA seq 411 aa
MNAETCVSYCESPAAAMDAYYSPVSQSREGSSPFRAFPGGDKFGTTFLSAAAKAQGFGDA
KSRARYGAGQQDLATPLESGAGARGSFNKFQPQPSTPQPQPPPQPQPQQQQPQPQPPAQP
HLYLQRGACKTPPDGSLKLQEGSSGHSAALQVPCYAKESSLGEPELPPDSDTVGMDSSYL
SVKEAGVKGPQDRASSDLPSPLEKADSESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPD
VYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFSTAYELPLLTRAENY
AQIQNPSWLGNNGAASPVPACVVPCDPVPACMSPHAHPPGSGASSVTDFLSVSGAGSHVG
QTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMKAKEHSAAISWAT
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgaatgctgagacttgcgtctcttactgcgagtcgccggccgctgccatggacgcctac
tacagcccggtgtcgcagagtcgggagggctcgtcgccttttagggcatttcccggaggc
gacaagttcggcacaactttcctgtcggccgccgccaaagcacagggattcggggacgcc
aagagccgggcccgttacggcgctgggcagcaggacctggcgacacccctggagagtgga
gctggggcgcggggctcctttaacaagttccagccccagccgtcgaccccgcagccccag
ccgccgccgcagccgcagccgcagcagcagcagccgcagccccagccgcccgcgcaaccg
catctttacttgcagcgaggcgcctgcaagacgcccccggacggcagcctcaaactccag
gaaggcagcagcggccacagcgcggccttgcaggttccctgctacgctaaagagagctcc
ctgggtgagccagagttaccccctgactctgacactgtggggatggacagcagctacctg
agtgtcaaggaggctggggtgaaggggccccaggaccgggccagctcagacctccccagc
ccattggagaaggccgactcagagagcaacaagggcaagaagcggcggaaccggaccacc
ttcaccagctaccagctggaggagctggagaaggtcttccagaagacccactacccagac
gtgtatgcgcgggaacagctggccatgaggacagacctcactgaggcccgcgtgcaggtc
tggttccagaaccgaagggccaagtggaggaagcgggagcgttttgggcagatgcagcag
gttcgaacccacttctccactgcatatgagctgcccctcctcacccgagctgagaactac
gcccagattcagaacccgtcctggctcggcaacaacggggctgcctcaccagtgccagcc
tgcgtggtcccctgcgacccggtgcctgcctgcatgtcccctcatgcccacccccctggc
tctggggccagcagcgtcaccgacttcctgagtgtgtctggggctggcagtcacgtgggc
cagacgcacatgggcagcctgtttggagcagccagcctcagcccaggcctcaatggctac
gagctcaacggcgagccggaccgcaagacctcgagcatcgcggccctccgcatgaaggcc
aaggagcacagtgcggccatttcctgggccacatga

DBGET integrated database retrieval system