KEGG   Homo sapiens (human): 6097Help
Entry
6097              CDS       T01001                                 

Gene name
RORC, IMD42, NR1F3, RORG, RZR-GAMMA, RZRG, TOR
Definition
(RefSeq) RAR related orphan receptor C
  KO
K08534  RAR-related orphan receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04659  Th17 cell differentiation
hsa04710  Circadian rhythm
hsa05321  Inflammatory bowel disease (IBD)
Disease
H00089  IFN-gamma/IL-12 axis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    6097 (RORC)
  09159 Environmental adaptation
   04710 Circadian rhythm
    6097 (RORC)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    6097 (RORC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6097 (RORC)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    6097 (RORC)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone-like
    6097 (RORC)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   6097 (RORC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep DUF4647
Motif
Other DBs
NCBI-GeneID: 6097
NCBI-ProteinID: NP_005051
OMIM: 602943
HGNC: 10260
Ensembl: ENSG00000143365
Vega: OTTHUMG00000013053
Pharos: P51449(Tchem)
UniProt: P51449 Q6I9R9
LinkDB All DBs
Structure
PDB: 

Position
1q21.3
AA seq 518 aa AA seqDB search
MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQR
CNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQK
QLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS
GSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPG
LGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIF
SREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEV
VLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALY
TALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHV
ERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggacagggccccacagagacagcaccgagcctcacgggagctgctggctgcaaagaag
acccacacctcacaaattgaagtgatcccttgcaaaatctgtggggacaagtcgtctggg
atccactacggggttatcacctgtgaggggtgcaagggcttcttccgccggagccagcgc
tgtaacgcggcctactcctgcacccgtcagcagaactgccccatcgaccgcaccagccga
aaccgatgccagcactgccgcctgcagaaatgcctggcgctgggcatgtcccgagatgct
gtcaagttcggccgcatgtccaagaagcagagggacagcctgcatgcagaagtgcagaaa
cagctgcagcagcggcaacagcagcaacaggaaccagtggtcaagacccctccagcaggg
gcccaaggagcagataccctcacctacaccttggggctcccagacgggcagctgcccctg
ggctcctcgcctgacctgcctgaggcttctgcctgtccccctggcctcctgaaagcctca
ggctctgggccctcatattccaacaacttggccaaggcagggctcaatggggcctcatgc
caccttgaatacagccctgagcggggcaaggctgagggcagagagagcttctatagcaca
ggcagccagctgacccctgaccgatgtggacttcgttttgaggaacacaggcatcctggg
cttggggaactgggacagggcccagacagctacggcagccccagtttccgcagcacaccg
gaggcaccctatgcctccctgacagagatagagcacctggtgcagagcgtctgcaagtcc
tacagggagacatgccagctgcggctggaggacctgctgcggcagcgctccaacatcttc
tcccgggaggaagtgactggctaccagaggaagtccatgtgggagatgtgggaacggtgt
gcccaccacctcaccgaggccattcagtacgtggtggagttcgccaagaggctctcaggc
tttatggagctctgccagaatgaccagattgtgcttctcaaagcaggagcaatggaagtg
gtgctggttaggatgtgccgggcctacaatgctgacaaccgcacggtcttttttgaaggc
aaatacggtggcatggagctgttccgagccttgggctgcagcgagctcatcagctccatc
tttgacttctcccactccctaagtgccttgcacttttccgaggatgagattgccctctac
acagcccttgttctcatcaatgcccatcggccagggctccaagagaaaaggaaagtagaa
cagctgcagtacaatctggagctggcctttcatcatcatctctgcaagactcatcgccaa
agcatcctggcaaagctgccacccaaggggaagcttcggagcctgtgtagccagcatgtg
gaaaggctgcagatcttccagcacctccaccccatcgtggtccaagccgctttccctcca
ctctacaaggagctcttcagcactgaaaccgagtcacctgtggggctgtccaagtga

DBGET integrated database retrieval system