KEGG   Homo sapiens (human): 6240Help
Entry
6240              CDS       T01001                                 

Gene name
RRM1, R1, RIR1, RR1
Definition
(RefSeq) ribonucleotide reductase catalytic subunit M1
  KO
K10807  ribonucleoside-diphosphate reductase subunit M1 [EC:1.17.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa00480  Glutathione metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Drug target
Caracemide: D03378
Cladribine: D01370
Clofarabine: D03546
Fludarabine (DG00685): D01907 D07966
Gemcitabine (DG00688): D01155 D02368 D10222
Tezacitabine: D06100
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    6240 (RRM1)
   00240 Pyrimidine metabolism
    6240 (RRM1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    6240 (RRM1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    6240 (RRM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    6240 (RRM1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     6240 (RRM1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    6240 (RRM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN ATP-cone
Motif
Other DBs
NCBI-GeneID: 6240
NCBI-ProteinID: NP_001024
OMIM: 180410
HGNC: 10451
Ensembl: ENSG00000167325
Vega: OTTHUMG00000133361
Pharos: P23921(Tclin)
UniProt: P23921
LinkDB All DBs
Structure
PDB: 

Position
11p15.4
AA seq 792 aa AA seqDB search
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLA
AETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKST
LDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHK
EDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCAL
ISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIY
LEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLD
EVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNL
GTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVVVRNLNKI
IDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGAL
EASCDLAKEQGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIA
PMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQII
ACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKL
TSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCS
LENRDECLMCGS
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtgatcaagcgagatggccgccaagaacgagtcatgtttgacaaaattacatct
cgaatccagaagctttgttatggactcaatatggattttgttgatcctgctcagatcacc
atgaaagtaatccaaggcttgtacagtggggtcaccacagtggaactagatactttggct
gctgaaacagctgcaaccttgactactaagcaccctgactatgctatcctggcagccagg
atcgctgtctctaacttgcacaaagaaacaaagaaagtgttcagtgatgtgatggaagac
ctctataactacataaatccacataatggcaaacactctcccatggtggccaagtcaaca
ttggatattgttctggccaataaagatcgcctgaattctgctattatctatgaccgagat
ttctcttacaattacttcggctttaagacgctagagcggtcttatttgttgaagatcaat
ggaaaagtggctgaaagaccacaacatatgttgatgagagtatctgttgggatccacaaa
gaagacattgatgcagcaattgaaacatataatcttctttctgagaggtggtttactcat
gcttcgcccactctcttcaatgctggtaccaaccgcccacaactttctagctgttttctt
ctgagtatgaaagatgacagcattgaaggcatttatgacactctaaagcaatgtgcattg
atttctaagtctgctggaggaattggtgttgctgtgagttgtattcgggctactggcagc
tacattgctgggactaatggcaattccaatggccttgtaccgatgctgagagtatataac
aacacagctcgatatgtggatcaaggtgggaacaagcgtcctggggcatttgctatttac
ctggagccttggcatttagacatctttgaattccttgatttaaagaagaacacaggaaag
gaagagcagcgtgccagagatcttttctttgctctttggattccggatctcttcatgaaa
cgagtggagactaatcaggactggtctttgatgtgtccaaatgagtgtcctggtctggat
gaggtttggggagaggaatttgagaaactatatgcaagttatgagaaacaaggtcgtgtc
cgcaaagttgtaaaagctcagcagctttggtatgccatcattgagtctcagacggaaaca
ggcaccccgtatatgctctacaaagattcctgtaatcgaaagagcaaccagcagaacctg
ggaaccatcaaatgcagcaacctgtgcacagaaatagtggagtacaccagcaaagatgag
gttgctgtttgtaatttggcttccctggccctgaatatgtatgtcacatcagaacacaca
tacgactttaagaagttggctgaagtcactaaagtcgttgtccgaaacttgaataaaatt
attgatataaactactatcctgtaccagaggcatgcctatcaaataaacgccatcgcccc
attggaattggggtacaaggtctggcagatgcttttatcctgatgagatacccttttgag
agtgcagaagcccagttactgaataagcagatctttgaaactatttattatggtgctctg
gaagccagctgtgaccttgccaaggagcagggcccatacgaaacctatgagggctctcca
gttagcaaaggaattcttcagtatgatatgtggaatgttactcctacagacctatgggac
tggaaggttctcaaggagaagattgcaaagtatggtataagaaacagtttacttattgcc
ccgatgcctacagcttccactgctcagatcctggggaataatgagtccattgaaccttac
accagcaacatctatactcgcagagtcttgtcaggagaatttcagattgtaaatcctcac
ttattgaaagatcttaccgagcggggcctatggcatgaagagatgaaaaaccagattatt
gcatgcaatggctctattcagagcataccagaaattcctgatgacctgaagcaactttat
aaaactgtgtgggaaatctctcagaaaactgttctcaagatggcagctgagagaggtgct
ttcattgatcaaagccaatctttgaacatccacattgctgagcctaactatggcaaactc
actagtatgcacttctacggctggaagcagggtttgaagactgggatgtattatttaagg
acaagaccagcggctaatccaatccagttcactctaaataaggagaagctaaaagataaa
gaaaaggtatcaaaagaggaagaagagaaggagaggaacacagcagccatggtgtgctct
ttggagaatagagatgaatgtctgatgtgtggatcctga

DBGET integrated database retrieval system