KEGG   Homo sapiens (human): 6256Help
Entry
6256              CDS       T01001                                 

Gene name
RXRA, NR2B1
Definition
(RefSeq) retinoid X receptor alpha
  KO
K08524  retinoid X receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04659  Th17 cell differentiation
hsa04919  Thyroid hormone signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04976  Bile secretion
hsa05160  Hepatitis C
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05216  Thyroid cancer
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05226  Gastric cancer
Network
nt06163  Hepatitis C virus (HCV)
nt06240  Transcription
nt06274  Thyroid cancer
  Element
N00126  PAX8-PPARG fusion to PPARG-mediated transcription
N00529  HCV core to RXRA/PPARA-mediated transcription
N00530  HCV core to RXRA/LXRA-mediated transcription
Drug target
Acitretin: D02754
Alitretinoin: D02815
Bexarotene: D03106
Etretinate: D00316
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    6256 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    6256 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    6256 (RXRA)
   03320 PPAR signaling pathway
    6256 (RXRA)
   04919 Thyroid hormone signaling pathway
    6256 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    6256 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    6256 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6256 (RXRA)
   05202 Transcriptional misregulation in cancer
    6256 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    6256 (RXRA)
   05216 Thyroid cancer
    6256 (RXRA)
   05222 Small cell lung cancer
    6256 (RXRA)
   05223 Non-small cell lung cancer
    6256 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    6256 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    6256 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6256 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    6256 (RXRA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    6256 (RXRA)
Nuclear receptors [BR:hsa03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   6256 (RXRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Motif
Other DBs
NCBI-GeneID: 6256
NCBI-ProteinID: NP_002948
OMIM: 180245
HGNC: 10477
Ensembl: ENSG00000186350
Vega: OTTHUMG00000020887
Pharos: P19793(Tclin)
UniProt: P19793 F1D8Q5 Q6P3U7
LinkDB All DBs
Structure
PDB: 

Position
9q34.2
AA seq 462 aa AA seqDB search
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaaacatttcctgccgctcgatttctccacccaggtgaactcctccctcacc
tccccgacggggcgaggctccatggctgccccctcgctgcacccgtccctggggcctggc
atcggctccccgggacagctgcattctcccatcagcaccctgagctcccccatcaacggc
atgggcccgcctttctcggtcatcagctcccccatgggcccccactccatgtcggtgccc
accacacccaccctgggcttcagcactggcagcccccagctcagctcacctatgaacccc
gtcagcagcagcgaggacatcaagccccccctgggcctcaatggcgtcctcaaggtcccc
gcccacccctcaggaaacatggcttccttcaccaagcacatctgcgccatctgcggggac
cgctcctcaggcaagcactatggagtgtacagctgcgaggggtgcaagggcttcttcaag
cggacggtgcgcaaggacctgacctacacctgccgcgacaacaaggactgcctgattgac
aagcggcagcggaaccggtgccagtactgccgctaccagaagtgcctggccatgggcatg
aagcgggaagccgtgcaggaggagcggcagcgtggcaaggaccggaacgagaatgaggtg
gagtcgaccagcagcgccaacgaggacatgccggtggagaggatcctggaggctgagctg
gccgtggagcccaagaccgagacctacgtggaggcaaacatggggctgaaccccagctcg
ccgaacgaccctgtcaccaacatttgccaagcagccgacaaacagcttttcaccctggtg
gagtgggccaagcggatcccacacttctcagagctgcccctggacgaccaggtcatcctg
ctgcgggcaggctggaatgagctgctcatcgcctccttctcccaccgctccatcgccgtg
aaggacgggatcctcctggccaccgggctgcacgtccaccggaacagcgcccacagcgca
ggggtgggcgccatctttgacagggtgctgacggagcttgtgtccaagatgcgggacatg
cagatggacaagacggagctgggctgcctgcgcgccatcgtcctctttaaccctgactcc
aaggggctctcgaacccggccgaggtggaggcgctgagggagaaggtctatgcgtccttg
gaggcctactgcaagcacaagtacccagagcagccgggaaggttcgctaagctcttgctc
cgcctgccggctctgcgctccatcgggctcaaatgcctggaacatctcttcttcttcaag
ctcatcggggacacacccattgacaccttccttatggagatgctggaggcgccgcaccaa
atgacttag

KEGG   Homo sapiens (human): 6257Help
Entry
6257              CDS       T01001                                 

Gene name
RXRB, DAUDI6, H-2RIIBP, NR2B2, RCoR-1
Definition
(RefSeq) retinoid X receptor beta
  KO
K08525  retinoid X receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04659  Th17 cell differentiation
hsa04919  Thyroid hormone signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05216  Thyroid cancer
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05226  Gastric cancer
Network
nt06240  Transcription
nt06274  Thyroid cancer
  Element
N00126  PAX8-PPARG fusion to PPARG-mediated transcription
Drug target
Acitretin: D02754
Adapalene: D01112
Alitretinoin: D02815
Bexarotene: D03106
Etretinate: D00316
Tazarotene: D01132
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    6257 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    6257 (RXRB)
   03320 PPAR signaling pathway
    6257 (RXRB)
   04919 Thyroid hormone signaling pathway
    6257 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    6257 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6257 (RXRB)
   05202 Transcriptional misregulation in cancer
    6257 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    6257 (RXRB)
   05216 Thyroid cancer
    6257 (RXRB)
   05222 Small cell lung cancer
    6257 (RXRB)
   05223 Non-small cell lung cancer
    6257 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6257 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    6257 (RXRB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    6257 (RXRB)
Nuclear receptors [BR:hsa03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   6257 (RXRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Motif
Other DBs
NCBI-GeneID: 6257
NCBI-ProteinID: NP_068811
OMIM: 180246
HGNC: 10478
Ensembl: ENSG00000204231
Vega: OTTHUMG00000031298
Pharos: P28702(Tclin)
UniProt: P28702 Q5STP9
LinkDB All DBs
Structure
PDB: 

Position
6p21.32
AA seq 533 aa AA seqDB search
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQT
PEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPP
PPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVK
PPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS
CRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMP
VDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHF
SSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRV
LTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYP
EQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggccgctcgcccgcccttcctccctcagcggcatgccgcagggcagtgtggg
ccggtgggggtgcgaaaagaaatgcattgtggggtcgcgtcccggtggcggcggcgacgg
ccctggctggatcccgcagcggcggcggcggcggcggtggcaggcggagaacaacaaacc
ccggagccggagccaggggaggctggacgggacgggatgggcgacagcgggcgggactcc
cgaagcccagacagctcctccccaaatccccttccccagggagtccctcccccttctcct
cctgggccacccctacccccttcaacagctccatcccttggaggctctggggccccaccc
ccacccccgatgccaccacccccactgggctctccctttccagtcatcagttcttccatg
gggtcccctggtctgccccctccagctcccccaggattctccgggcctgtcagcagcccc
cagattaactcaacagtgtcactccctgggggtgggtctggcccccctgaagatgtgaag
ccaccagtcttaggggtccggggcctgcactgtccaccccctccaggtggccctggggct
ggcaaacggctatgtgcaatctgcggggacagaagctcaggcaaacactacggggtttac
agctgtgagggttgcaagggcttcttcaaacgcaccatccgcaaagaccttacatactct
tgccgggacaacaaagactgcacagtggacaagcgccagcggaaccgctgtcagtactgc
cgctatcagaagtgcctggccactggcatgaagagggaggcggtacaggaggagcgtcag
cggggaaaggacaaggatggggatggggagggggctgggggagcccccgaggagatgcct
gtggacaggatcctggaggcagagcttgctgtggaacagaagagtgaccagggcgttgag
ggtcctgggggaaccgggggtagcggcagcagcccaaatgaccctgtgactaacatctgt
caggcagctgacaaacagctattcacgcttgttgagtgggcgaagaggatcccacacttt
tcctccttgcctctggatgatcaggtcatattgctgcgggcaggctggaatgaactcctc
attgcctccttctcacaccgatccattgatgttcgagatggcatcctccttgccacaggt
cttcacgtgcaccgcaactcagcccattcagcaggagtaggagccatctttgatcgggtg
ctgacagagctagtgtccaaaatgcgtgacatgaggatggacaagacagagcttggctgc
ctgagggcaatcattctgtttaatccagatgccaagggcctctccaaccctagtgaggtg
gaggtcctgcgggagaaagtgtatgcatcactggagacctactgcaaacagaagtaccct
gagcagcagggacggtttgccaagctgctgctacgtcttcctgccctccggtccattggc
cttaagtgtctagagcatctgtttttcttcaagctcattggtgacacccccatcgacacc
ttcctcatggagatgcttgaggctccccatcaactggcctga

KEGG   Homo sapiens (human): 6258Help
Entry
6258              CDS       T01001                                 

Gene name
RXRG, NR2B3, RXRC
Definition
(RefSeq) retinoid X receptor gamma
  KO
K08526  retinoid X receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04659  Th17 cell differentiation
hsa04919  Thyroid hormone signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05216  Thyroid cancer
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05226  Gastric cancer
Network
nt06240  Transcription
nt06274  Thyroid cancer
  Element
N00126  PAX8-PPARG fusion to PPARG-mediated transcription
Drug target
Acitretin: D02754
Adapalene: D01112
Alitretinoin: D02815
Bexarotene: D03106
Etretinate: D00316
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    6258 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    6258 (RXRG)
   03320 PPAR signaling pathway
    6258 (RXRG)
   04919 Thyroid hormone signaling pathway
    6258 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    6258 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6258 (RXRG)
   05202 Transcriptional misregulation in cancer
    6258 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    6258 (RXRG)
   05216 Thyroid cancer
    6258 (RXRG)
   05222 Small cell lung cancer
    6258 (RXRG)
   05223 Non-small cell lung cancer
    6258 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6258 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    6258 (RXRG)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    6258 (RXRG)
Nuclear receptors [BR:hsa03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   6258 (RXRG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Motif
Other DBs
NCBI-GeneID: 6258
NCBI-ProteinID: NP_008848
OMIM: 180247
HGNC: 10479
Ensembl: ENSG00000143171
Vega: OTTHUMG00000034626
Pharos: P48443(Tclin)
UniProt: P48443 F1D8Q7
LinkDB All DBs
Structure
PDB: 

Position
1q23.3
AA seq 463 aa AA seqDB search
MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECATSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaaattattctcacttcatgaagtttcccgcaggctatggaggctcccctggc
cacactggctctacatccatgagcccatcagcagccttgtccacagggaagccaatggac
agccaccccagctacacagataccccagtgagtgccccacggactctgagtgcagtgggg
acccccctcaatgccctgggctctccatatcgagtcatcacctctgccatgggcccaccc
tcaggagcacttgcagcgcctccaggaatcaacttggttgccccacccagctctcagcta
aatgtggtcaacagtgtcagcagttcagaggacatcaagcccttaccagggcttcccggg
attggaaacatgaactacccatccaccagccccggatctctggttaaacacatctgtgcc
atctgtggagacagatcctcaggaaagcactacggggtatacagttgtgaaggctgcaaa
gggttcttcaagaggacgataaggaaggacctcatctacacgtgtcgggataataaagac
tgcctcattgacaagcgtcagcgcaaccgctgccagtactgtcgctatcagaagtgcctt
gtcatgggcatgaagagggaagctgtgcaagaagaaagacagaggagccgagagcgagct
gagagtgaggcagaatgtgctaccagtggtcatgaagacatgcctgtggagaggattcta
gaagctgaacttgctgttgaaccaaagacagaatcctatggtgacatgaatatggagaac
tcgacaaatgaccctgttaccaacatatgtcatgctgctgacaagcagcttttcaccctc
gttgaatgggccaagcgtattccccacttctctgacctcaccttggaggaccaggtcatt
ttgcttcgggcagggtggaatgaattgctgattgcctctttctcccaccgctcagtttcc
gtgcaggatggcatccttctggccacgggtttacatgtccaccggagcagtgcccacagt
gctggggtcggctccatctttgacagagtcctaactgagctggtttccaaaatgaaagac
atgcagatggacaagtcggaactgggatgcctgcgagccattgtactctttaacccagat
gccaagggcctgtccaacccctctgaggtggagactctgcgagagaaggtttatgccacc
cttgaggcctacaccaagcagaagtatccggaacagccaggcaggtttgccaagctgctg
ctgcgcctcccagctctgcgttccattggcttgaaatgcctggagcacctcttcttcttc
aagctcatcggggacacccccattgacaccttcctcatggagatgttggagaccccgctg
cagatcacctga

KEGG   Homo sapiens (human): 5468Help
Entry
5468              CDS       T01001                                 

Gene name
PPARG, CIMT1, GLM1, NR1C3, PPARG1, PPARG2, PPARgamma
Definition
(RefSeq) peroxisome proliferator activated receptor gamma
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04380  Osteoclast differentiation
hsa04714  Thermogenesis
hsa05016  Huntington disease
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05216  Thyroid cancer
Network
nt06240  Transcription
nt06274  Thyroid cancer
  Element
N00126  PAX8-PPARG fusion to PPARG-mediated transcription
N00138  EWSR1-NR4A3
Disease
H00032  Thyroid cancer
H00409  Type 2 diabetes mellitus
H00420  Familial partial lipodystrophy
H02106  Genetic obesity
Drug target
Aleglitazar: D08845
Arhalofenate: D09579
Ciglitazone: D03493
Darglitazone sodium: D03653
Edaglitazone sodium: D03941
Englitazone sodium: D03996
Farglitazar: D04132
Halofenate: D04411
Indeglitazar: D09350
Mifobate: D05030
Muraglitazar: D05091
Netoglitazone: D05150
Peliglitazar: D05397
Pioglitazone (DG00117): D00945 D08378
Reglitazar: D01971
Rivoglitazone: D05739
Rosiglitazone (DG00116): D00596 D08491
Seladelpar (DG02957): D11256 D11257
Sodelglitazar: D06647
Tesaglitazar: D01274
Troglitazone: D00395
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    5468 (PPARG)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    5468 (PPARG)
  09158 Development
   04380 Osteoclast differentiation
    5468 (PPARG)
  09149 Aging
   04211 Longevity regulating pathway
    5468 (PPARG)
  09159 Environmental adaptation
   04714 Thermogenesis
    5468 (PPARG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5468 (PPARG)
   05202 Transcriptional misregulation in cancer
    5468 (PPARG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    5468 (PPARG)
  09164 Neurodegenerative disease
   05016 Huntington disease
    5468 (PPARG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5468 (PPARG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    5468 (PPARG)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    5468 (PPARG)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   5468 (PPARG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep Tmemb_55A
Motif
Other DBs
NCBI-GeneID: 5468
NCBI-ProteinID: NP_056953
OMIM: 601487
HGNC: 9236
Ensembl: ENSG00000132170
Vega: OTTHUMG00000129764
Pharos: P37231(Tclin)
UniProt: P37231
LinkDB All DBs
Structure
PDB: 
3U9Q 3V9V 3B1M 3V9T 5Y2T 6IZN 4CI5 6IZM 5Z6S 5Z5S 5Y2O 1ZGY 5GTN 6DHA 3WJ5 6D8X 6D94 4F9M 3LMP 2ZVT 5TWO 6MD0 6DGL 6FZF 3WJ4 3ADX 3ET3 2HWQ 5JI0 4Y29 3NOA 2FVJ 5YCP 5LSG 5HZC 3VSO 4A4V 4A4W 3TY0 2YFE 3R5N 2HFP 6FZJ 3FEJ 2XKW 2VSR 2Q5S 3ADW 2F4B 6MCZ 6FZG 6F2L 5UGM 5GTO 3WMH 4EM9 3V9Y 3T03 3B0Q 3KMG 3HOD 3H0A 2I4J 2I4P 2GTK 1FM6 1FM9 6DGR 5YCN 3B0R 3VN2 6MD1 6MD2 6AD9 6ENQ 5DWL 4YT1 2VV1 2Q61 2Q59 1PRG 4XUH 4R06 3VJH 6MD4 5TTO 5F9B 3ADS 2P4Y 2I4Z 6C1I 2ZK2 3ADV 3BC5 4L98 2ATH 6AVI 5WQX 6FZP 5DVC 3X1H 4R6S 4R2U 4OJ4 3SZ1 3R8I 3PBA 3AN3 3AN4 3GBK 3G9E 3FUR 3CS8 2Q8S 2Q5P 2POB 2G0H 1K74 2PRG 3IA6 5WR1 2HWR 5GTP 3PO9 2VV4 2VST 1I7I 2ZK0 4L96 6E5A 6D3E 6C5Q 4XUM 3X1I 3VSP 3ET0 3D6D 2ZNO 3CWD 2Q6S 1RDT 3R8A 2ZK6 2Q6R 6DGQ 4XLD 2ZK5 4XTA 4JL4 4HEE 4E4K 4E4Q 3QT0 1ZEO 1KNU 4EMA 2G0G 5U5L 3S9S 3OSW 3K8S 2VV0 2ZK4 2ZK3 6DBH 4PWL 4PVU 4O8F 3HO0 3B3K 3VJI 2ZK1 3CDS 1NYX 6AN1 6DH9 5AZV 3OSI 3ADT 6AUG 6C5T 5DV3 5DV8 2VV2 3ADU 5DV6 3CDP 2OM9 4FGY 5WR0 4JAZ 2VV3 1WM0 4PRG 3PRG 6DCU 5DSH 6DGO 6DGP 6FZY 3DZY 3E00 3DZU 2QMV
Thumbnails

Position
3p25.2
AA seq 505 aa AA seqDB search
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaactctgggagattctcctattgacccagaaagcgattccttcactgataca
ctgtctgcaaacatatcacaagaaatgaccatggttgacacagagatgccattctggccc
accaactttgggatcagctccgtggatctctccgtaatggaagaccactcccactccttt
gatatcaagcccttcactactgttgacttctccagcatttctactccacattacgaagac
attccattcacaagaacagatccagtggttgcagattacaagtatgacctgaaacttcaa
gagtaccaaagtgcaatcaaagtggagcctgcatctccaccttattattctgagaagact
cagctctacaataagcctcatgaagagccttccaactccctcatggcaattgaatgtcgt
gtctgtggagataaagcttctggatttcactatggagttcatgcttgtgaaggatgcaag
ggtttcttccggagaacaatcagattgaagcttatctatgacagatgtgatcttaactgt
cggatccacaaaaaaagtagaaataaatgtcagtactgtcggtttcagaaatgccttgca
gtggggatgtctcataatgccatcaggtttgggcggatgccacaggccgagaaggagaag
ctgttggcggagatctccagtgatatcgaccagctgaatccagagtccgctgacctccgg
gccctggcaaaacatttgtatgactcatacataaagtccttcccgctgaccaaagcaaag
gcgagggcgatcttgacaggaaagacaacagacaaatcaccattcgttatctatgacatg
aattccttaatgatgggagaagataaaatcaagttcaaacacatcacccccctgcaggag
cagagcaaagaggtggccatccgcatctttcagggctgccagtttcgctccgtggaggct
gtgcaggagatcacagagtatgccaaaagcattcctggttttgtaaatcttgacttgaac
gaccaagtaactctcctcaaatatggagtccacgagatcatttacacaatgctggcctcc
ttgatgaataaagatggggttctcatatccgagggccaaggcttcatgacaagggagttt
ctaaagagcctgcgaaagccttttggtgactttatggagcccaagtttgagtttgctgtg
aagttcaatgcactggaattagatgacagcgacttggcaatatttattgctgtcattatt
ctcagtggagaccgcccaggtttgctgaatgtgaagcccattgaagacattcaagacaac
ctgctacaagccctggagctccagctgaagctgaaccaccctgagtcctcacagctgttt
gccaagctgctccagaaaatgacagacctcagacagattgtcacggaacacgtgcagcta
ctgcaggtgatcaagaagacggagacagacatgagtcttcacccgctcctgcaggagatc
tacaaggacttgtactag

DBGET integrated database retrieval system