KEGG   Homo sapiens (human): 6259
Entry
6259              CDS       T01001                                 

Gene name
RYK, D3S3195, JTK5, JTK5A, RYK1
Definition
(RefSeq) receptor like tyrosine kinase
  KO
K05128  RYK receptor-like tyrosine kinase [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6259 (RYK)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    6259 (RYK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6259 (RYK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     6259 (RYK)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  RYK family
   6259 (RYK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr WIF Pkinase
Other DBs
NCBI-GeneID: 6259
NCBI-ProteinID: NP_002949
OMIM: 600524
HGNC: 10481
Ensembl: ENSG00000163785
Vega: OTTHUMG00000159750
Pharos: P34925(Tbio)
UniProt: P34925 Q8WTZ8 Q59FQ5
LinkDB
Position
3q22.2
AA seq 607 aa
MRGAARLGRPGRSCLPGARGLRAPPPPPLLLLLALLPLLPAPGAAAAPAPRPPELQSASA
GPSVSLYLSEDEVRRLIGLDAELYYVRNDLISHYALSFSLLVPSETNFLHFTWHAKSKVE
YKLGFQVDNVLAMDMPQVNISVQGEVPRTLSVFRVELSCTGKVDSEVMILMQLNLTVNSS
KNFTVLNFKRRKMCYKKLEEVKTSALDKNTSRTIYDPVHAAPTTSTRVFYISVGVCCAVI
FLVAIILAVLHLHSMKRIELDDSISASSSSQGLSQPSTQTTQYLRADTPNNATPITSYPT
LRIEKNDLRSVTLLEAKGKVKDIAISRERITLKDVLQEGTFGRIFHGILIDEKDPNKEKQ
AFVKTVKDQASEIQVTMMLTESCKLRGLHHRNLLPITHVCIEEGEKPMVILPYMNWGNLK
LFLRQCKLVEANNPQAISQQDLVHMAIQIACGMSYLARREVIHKDLAARNCVIDDTLQVK
ITDNALSRDLFPMDYHCLGDNENRPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQ
TPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFH
AALGAYV
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgcgtggggcggcgcggctggggcggccgggccggagttgcctcccgggggcccgcggc
ctgagggccccgccgccgccgccgctgctgcttctgcttgcgctgttgccgctgctgccc
gcgcctggcgctgccgccgcccccgccccgcggcccccggagctgcagtcggcttccgcg
gggcccagcgtgagtctctacctgagcgaggacgaggtgcgccggctgatcggtcttgat
gcagaactttattatgtgagaaatgaccttattagtcactacgctctatcctttagtctg
ttagtacccagtgagacaaatttcctgcacttcacctggcatgcgaagtccaaggttgaa
tataagctgggattccaagtggacaatgttttggcaatggatatgccccaggtcaacatt
tctgttcagggggaagttccacgcactttatcagtgtttcgggtagagctttcctgtact
ggcaaagtagattctgaagttatgatactaatgcagctcaacttgacagtaaattcttca
aaaaattttaccgtcttaaattttaaacgaaggaaaatgtgctacaaaaaacttgaagaa
gtaaaaacttcagccttggacaaaaacactagcagaactatttatgatcctgtacatgca
gctccaaccacttctacgcgtgtgttttatattagtgtaggggtttgttgtgcagtaata
tttctcgtagcaataatattagctgttttgcaccttcatagtatgaaaaggattgaactg
gatgacagcattagtgccagcagtagttcccaagggctgtctcagccatccacccagacg
actcagtatctgagagcagacacgcccaacaatgcaactcctatcaccagttatcctacc
ttgcggatagagaagaacgacttgagaagtgtcactcttttggaggccaaaggcaaggtg
aaggatatagcaatatccagagagaggataactctaaaagatgtactccaagaaggtact
tttgggcgtattttccatgggattttaatagatgaaaaagatccaaataaagaaaaacaa
gcatttgtcaaaacagttaaagatcaagcttctgaaattcaggtgacaatgatgctcact
gaaagttgtaagctgcgaggtcttcatcacagaaatcttcttcctattactcatgtgtgt
atagaagaaggagaaaagcccatggtgatattgccttacatgaattgggggaatcttaaa
ttgtttttacgacagtgcaagttagtagaggccaataatccacaggcaatttctcagcaa
gacctggtacacatggctattcagattgcctgtggaatgagctacctggccagaagggaa
gtcatccacaaagacctggctgccaggaactgtgtcattgatgacacacttcaagttaag
atcacagacaatgccctctccagagacttgttccccatggactatcactgtctgggggac
aatgaaaacaggccagttcgttggatggctcttgaaagtctggttaataacgagttctct
agcgctagtgatgtgtgggcctttggagtgacgctgtgggaactcatgactctgggccag
actccctacgtggacattgaccccttcgagatggccgcatacctgaaagatggttaccga
atagcccagccaatcaactgtcctgatgaattatttgctgtgatggcctgttgctgggcc
ttagatccagaggagaggcccaagtttcagcagctggtacagtgcctaacagagtttcat
gcagccctgggggcctacgtctga

DBGET integrated database retrieval system