KEGG   Homo sapiens (human): 6259Help
Entry
6259              CDS       T01001                                 

Gene name
RYK, D3S3195, JTK5, JTK5A, RYK1
Definition
(RefSeq) receptor like tyrosine kinase
  KO
K05128  RYK receptor-like tyrosine kinase [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6259 (RYK)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    6259 (RYK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6259 (RYK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     6259 (RYK)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  RYK family
   6259 (RYK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr WIF Pkinase
Motif
Other DBs
NCBI-GeneID: 6259
NCBI-ProteinID: NP_002949
OMIM: 600524
HGNC: 10481
Ensembl: ENSG00000163785
Vega: OTTHUMG00000159750
Pharos: P34925(Tbio)
UniProt: P34925 Q8WTZ8 Q59FQ5
LinkDB All DBs
Position
3q22.2
AA seq 607 aa AA seqDB search
MRGAARLGRPGRSCLPGARGLRAPPPPPLLLLLALLPLLPAPGAAAAPAPRPPELQSASA
GPSVSLYLSEDEVRRLIGLDAELYYVRNDLISHYALSFSLLVPSETNFLHFTWHAKSKVE
YKLGFQVDNVLAMDMPQVNISVQGEVPRTLSVFRVELSCTGKVDSEVMILMQLNLTVNSS
KNFTVLNFKRRKMCYKKLEEVKTSALDKNTSRTIYDPVHAAPTTSTRVFYISVGVCCAVI
FLVAIILAVLHLHSMKRIELDDSISASSSSQGLSQPSTQTTQYLRADTPNNATPITSYPT
LRIEKNDLRSVTLLEAKGKVKDIAISRERITLKDVLQEGTFGRIFHGILIDEKDPNKEKQ
AFVKTVKDQASEIQVTMMLTESCKLRGLHHRNLLPITHVCIEEGEKPMVILPYMNWGNLK
LFLRQCKLVEANNPQAISQQDLVHMAIQIACGMSYLARREVIHKDLAARNCVIDDTLQVK
ITDNALSRDLFPMDYHCLGDNENRPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQ
TPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFH
AALGAYV
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggggcggcgcggctggggcggccgggccggagttgcctcccgggggcccgcggc
ctgagggccccgccgccgccgccgctgctgcttctgcttgcgctgttgccgctgctgccc
gcgcctggcgctgccgccgcccccgccccgcggcccccggagctgcagtcggcttccgcg
gggcccagcgtgagtctctacctgagcgaggacgaggtgcgccggctgatcggtcttgat
gcagaactttattatgtgagaaatgaccttattagtcactacgctctatcctttagtctg
ttagtacccagtgagacaaatttcctgcacttcacctggcatgcgaagtccaaggttgaa
tataagctgggattccaagtggacaatgttttggcaatggatatgccccaggtcaacatt
tctgttcagggggaagttccacgcactttatcagtgtttcgggtagagctttcctgtact
ggcaaagtagattctgaagttatgatactaatgcagctcaacttgacagtaaattcttca
aaaaattttaccgtcttaaattttaaacgaaggaaaatgtgctacaaaaaacttgaagaa
gtaaaaacttcagccttggacaaaaacactagcagaactatttatgatcctgtacatgca
gctccaaccacttctacgcgtgtgttttatattagtgtaggggtttgttgtgcagtaata
tttctcgtagcaataatattagctgttttgcaccttcatagtatgaaaaggattgaactg
gatgacagcattagtgccagcagtagttcccaagggctgtctcagccatccacccagacg
actcagtatctgagagcagacacgcccaacaatgcaactcctatcaccagttatcctacc
ttgcggatagagaagaacgacttgagaagtgtcactcttttggaggccaaaggcaaggtg
aaggatatagcaatatccagagagaggataactctaaaagatgtactccaagaaggtact
tttgggcgtattttccatgggattttaatagatgaaaaagatccaaataaagaaaaacaa
gcatttgtcaaaacagttaaagatcaagcttctgaaattcaggtgacaatgatgctcact
gaaagttgtaagctgcgaggtcttcatcacagaaatcttcttcctattactcatgtgtgt
atagaagaaggagaaaagcccatggtgatattgccttacatgaattgggggaatcttaaa
ttgtttttacgacagtgcaagttagtagaggccaataatccacaggcaatttctcagcaa
gacctggtacacatggctattcagattgcctgtggaatgagctacctggccagaagggaa
gtcatccacaaagacctggctgccaggaactgtgtcattgatgacacacttcaagttaag
atcacagacaatgccctctccagagacttgttccccatggactatcactgtctgggggac
aatgaaaacaggccagttcgttggatggctcttgaaagtctggttaataacgagttctct
agcgctagtgatgtgtgggcctttggagtgacgctgtgggaactcatgactctgggccag
actccctacgtggacattgaccccttcgagatggccgcatacctgaaagatggttaccga
atagcccagccaatcaactgtcctgatgaattatttgctgtgatggcctgttgctgggcc
ttagatccagaggagaggcccaagtttcagcagctggtacagtgcctaacagagtttcat
gcagccctgggggcctacgtctga

DBGET integrated database retrieval system