KEGG   Homo sapiens (human): 6261Help
Entry
6261              CDS       T01001                                 

Gene name
RYR1, CCO, MHS, MHS1, PPP1R137, RYDR, RYR, RYR-1, SKRR
Definition
(RefSeq) ryanodine receptor 1
  KO
K04961  ryanodine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04371  Apelin signaling pathway
hsa04713  Circadian entrainment
hsa04730  Long-term depression
hsa04921  Oxytocin signaling pathway
hsa05017  Spinocerebellar ataxia
Disease
H00699  Central core disease
H01310  Multi-minicore disease
Drug target
Aladorian (DG02040): D10304 D10305
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    6261 (RYR1)
   04020 Calcium signaling pathway
    6261 (RYR1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    6261 (RYR1)
  09156 Nervous system
   04730 Long-term depression
    6261 (RYR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    6261 (RYR1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    6261 (RYR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    6261 (RYR1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    6261 (RYR1)
   04040 Ion channels [BR:hsa04040]
    6261 (RYR1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6261 (RYR1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6261 (RYR1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ryanodine receptor
   6261 (RYR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_8 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 6261
NCBI-ProteinID: NP_000531
OMIM: 180901
HGNC: 10483
Ensembl: ENSG00000196218
Vega: OTTHUMG00000182403
Pharos: P21817(Tclin)
UniProt: P21817
LinkDB All DBs
Position
19q13.2
AA seq 5038 aa AA seqDB search
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPD
LAICCFVLEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSCL
TTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQ
RRLVYYEGGAVCTHARSLWRLEPLRISWSGSHLRWGQPLRVRHVTTGQYLALTEDQGLVV
VDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSF
SGKPRGSGPPAGTALPIEGVILSLQDLIIYFEPPSEDLQHEEKQSKLRSLRNRQSLFQEE
GMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLD
VLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGTTQYSK
WYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVV
SFSAGVKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLVG
PSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMM
SNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVGQGWSYSAVQDIPARRNPRL
VPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGR
PWQPGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFREIEIGDGFLPVCSLGPGQVGH
LNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAED
EARAAEPDPDYENLRRSAGGWSEAENGKEGTAKEGAPGGTPQAGGEAQPARAENEKDATT
EKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFV
SPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNV
IQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRV
AHALCSHVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTPE
TRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVK
QILKMIEPEVFTEEEEEEDEEEEGEEEDEEEKEEDEEETAQEKEDEEKEEEEAAEGEKEE
GLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLA
HCGIQLDGEEEEPEEETTLGSRLMSLLEKVRLVKKKEEKPEEERSAEESKPRSLQELVSH
MVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGES
KEIRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASV
IDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRD
RRREHFGEEPPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRSL
VPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVD
SMLHTVYRLSRGRSLTKAQRDVIEDCLMSLCRYIRPSMLQHLLRRLVFDVPILNEFAKMP
LKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAE
YTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWE
WTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRG
LKDMELDSSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFAK
ILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQART
QVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTKN
TYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGA
PPPCTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLQSHFIP
TIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAK
AGDIQSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLITLAKTRY
ALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVS
AVLYYLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAA
WILTEDHSFEDRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDY
LYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQ
MISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSV
LDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQN
YLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQV
FNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQK
DMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQDYV
TDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGF
NVAVLLTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETN
RAQWEMPQVKESKRQFIFDVVNEGGEAEKMELFVSFCEDTIFEMQIAAQISEPEGEPETD
EDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRL
RRLTAREAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELL
AGMPDPTSDEVHGEQPAGPGGDADGEGASEGAGDAAEGAGDEEEAVHEAGPGGADGAVAV
TDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELE
PEKADAENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLNYLSRNF
YTLRFLALFLAFAINFILLFYKVSDSPPGEDDMEGSAAGDVSGAGSGGSSGWGLGAGEEA
EGDEDENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELAR
KLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIYGRERIAE
LLGMDLATLEITAHNERKPNPPPGLLTWLMSIDVKYQIWKFGVIFTDNSFLYLGWYMVMS
LLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFF
RKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDIT
FFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHT
LEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS
NT seq 15117 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgcagaaggcgaagacgaggtccagttcctgcggacggacgatgaggtggtc
ctgcagtgcagcgctaccgtgctcaaggagcagctcaagctctgcctggccgccgagggc
ttcggcaaccgcctgtgcttcctggagcccactagcaacgcgcagaatgtgccccccgat
ctggccatctgttgcttcgtcctggagcagtccctgtctgtgcgagccctgcaggagatg
ctggctaacacggtggaggctggcgtggagtcatcccagggcgggggacacaggacgctc
ctgtatggccatgccatcctgctccggcatgcacacagccgcatgtatctgagctgcctc
accacctcccgctccatgactgacaagctggccttcgatgtgggactgcaggaggacgca
acaggagaggcttgctggtggaccatgcacccagcctccaagcagaggtctgaaggagaa
aaggtccgcgttggggatgacatcatccttgtcagtgtctcctccgagcgctacctgcac
ctgtcgaccgccagtggggagctccaggttgacgcttccttcatgcagacactatggaac
atgaaccccatctgctcccgctgcgaagagggcttcgtgacgggaggtcacgtcctccgc
ctctttcatggacatatggatgagtgtctgaccatttcccctgctgacagtgatgaccag
cgcagacttgtctactatgaggggggagctgtgtgcactcatgcccgctccctctggagg
ctggagccactgagaatcagctggagtgggagccacctgcgctggggccagccactccga
gtccggcatgtcactaccgggcagtacctagcgctcaccgaggaccagggcctggtggtg
gttgacgccagcaaggctcacaccaaggctacctccttctgcttccgcatctccaaggag
aagctggatgtggcccccaagcgggatgtggagggcatgggcccccctgagatcaagtac
ggggagtcactgtgcttcgtgcagcatgtggcctcaggactgtggctcacctatgctgct
ccagaccccaaggccctgcggctcggcgtgctcaagaagaaggccatgctgcaccaggag
ggccacatggacgacgcactgtcgctgacccgctgccagcaggaggagtcccaggccgcc
cgcatgatccacagcaccaatggcctatacaaccagttcatcaagagcctggacagcttc
agcgggaagccacggggctcggggccacccgctggcacggcgctgcccatcgagggcgtt
atcctgagcctgcaggacctcatcatctacttcgagcctccctccgaggacttgcagcac
gaggagaagcagagcaagctgcgaagcctgcgcaaccgccagagcctcttccaggaggag
gggatgctctccatggtcctgaattgcatagaccgcctaaatgtctacaccactgctgcc
cactttgctgagtttgcaggggaggaggcagccgagtcctggaaagagattgtgaatctt
ctctatgaactcctagcttctctaatccgtggcaatcgtagcaactgtgccctcttctcc
acaaacttggactggctggtcagcaagctggatcggctggaggcctcgtctggcatcctg
gaggtcctgtactgtgtcctcattgagagtccagaggttctgaacatcatccaggagaat
cacatcaagtccatcatctccctcctggacaagcatgggaggaaccacaaggtcctggac
gtgctatgctccctgtgtgtgtgtaatggtgtggctgtacgctccaaccaagatcttatt
actgagaacttgctgcctggccgtgagcttctgctgcagacaaacctcatcaactatgtc
accagcatccgccccaacatctttgtgggccgagcggaaggcaccacgcagtacagcaaa
tggtactttgaggtgatggtggacgaggtgactccatttctgacagctcaggccacccac
ttgcgggtgggctgggccctcaccgagggctacaccccctaccctggggccggcgagggc
tggggcggcaacggggtcggcgatgacctctattcctacggctttgatggactgcatctc
tggacaggacacgtggcacgcccagtgacttccccagggcagcacctcctggcccctgaa
gacgtgatcagctgctgcctggacctcagcgtgccgtccatctccttccgcatcaacggc
tgccccgtgcagggtgtctttgagtccttcaacctggacgggctcttcttccctgttgtc
agcttctcggctggtgtcaaggtgcggttcctccttggtggccgccatggtgaattcaag
ttcctgcccccacctggctatgctccatgccatgaggctgtgctccctcgagagcgactc
catcttgaacccatcaaggagtatcgacgggaggggccccgggggcctcacctggtgggc
cccagtcgctgcctctcacacaccgacttcgtgccctgccctgtggacactgtccagatt
gtcctgccgccccatctggagcgcattcgggagaagctggcggagaacatccacgagctc
tgggcgctaacccgcatcgagcagggctggacctacggcccggttcgggatgacaacaag
aggctgcacccgtgtcttgtggacttccacagccttccagagcctgagaggaactacaac
ctgcagatgtctggggagacgctcaagactctgctggctctgggctgccacgtgggcatg
gcggatgagaaggcggaggacaacctgaagaagacaaaactccccaagacgtatatgatg
agcaatgggtacaagccggctccgctggacctgagccacgtgcggctgacgccggcgcag
acgacactggtggaccgtctggcagaaaatgggcacaacgtgtgggcccgagaccgcgtg
ggccagggctggagctacagcgcagtgcaggacatcccagcgcgccgaaaccctcggctg
gtgccctaccgcctgctggatgaagccaccaagcgcagcaaccgggacagcctctgccag
gccgtgcgcaccctcctgggctacggctacaacatcgagcctcctgaccaggagcccagt
caggtggagaaccagtctcgttgtgaccgggtgcgcatcttccgggcagagaaatcctat
acagtgcagagcggccgctggtacttcgagtttgaagcagtcaccacaggcgagatgcgc
gtgggctgggcgaggcccgagctgaggcctgatgtagagctgggagctgacgagctggcc
tatgtcttcaatgggcaccgcggccagcgctggcacttgggcagtgaaccatttgggcgc
ccctggcagccgggcgatgtcgttggctgtatgatcgacctcacagagaacaccattatc
ttcaccctcaatggcgaggtcctcatgtctgactcaggctccgaaacagccttccgggag
attgagattggggacggcttcctgcccgtctgcagcttgggacctggccaggtgggtcat
ctgaacctgggccaggacgtgagctctctgaggttctttgccatctgtggcctccaggaa
ggcttcgagccatttgccatcaacatgcagcgcccagtcaccacctggttcagcaaaggc
ctgccccagtttgagccagtgccccttgaacaccctcactatgaggtatcccgagtggac
ggcactgtggacacgcccccctgcctgcgcctgacccaccgcacctggggctcccagaac
agcctggtggagatgcttttcctgcggctgagcctcccagtccagttccaccagcacttc
cgctgcactgcaggggccaccccgctggcacctcctggcctgcagccccccgccgaggac
gaggcccgggcggcggaacccgaccctgactacgaaaacctgcgccgctcagctgggggc
tggagcgaggcagagaacggcaaagaagggactgcgaaggagggcgcccccgggggcacc
ccgcaggcggggggagaggcgcagcccgccagggcggagaatgagaaggatgccaccacc
gagaagaacaagaagagaggcttcttattcaaggccaagaaggtcgccatgatgacccag
ccaccggccacccccacgctgccccgactccctcacgacgtggtgcctgcagacaaccgc
gatgaccccgagatcatcctcaacaccaccacgtactattactccgtgagggtctttgct
ggacaggagcccagctgcgtgtgggcgggctgggtcacccctgactaccatcagcacgac
atgagcttcgacctcagcaaggtccgggtcgtgacggtgaccatgggggatgaacaaggc
aacgtccacagcagcctcaagtgtagcaactgctacatggtgtggggcggagactttgtg
agtcccgggcagcagggccggatcagccacacggaccttgtcattgggtgcctggtggac
ttggccactggcttaatgacctttacagccaatggcaaagagagcaacacctttttccag
gtggaacccaacactaagctatttcctgccgtcttcgtcctgcccacccaccagaacgtc
atccagtttgagctggggaagcagaagaacatcatgccgttgtcagccgccatgttccaa
agcgagcgcaagaacccggccccgcagtgcccaccgcggctggagatgcagatgctgatg
ccagtgtcctggagccgcatgcccaaccacttcctgcaggtggagacgaggcgtgccggc
gagcggctgggctgggccgtgcagtgccaggagccgctgaccatgatggcgctgcacatc
cccgaggagaaccggtgcatggacatcctggagctgtcggagcgcctggacctgcagcgc
ttccactcgcacaccctgcgcctctaccgcgctgtgtgcgccctgggcaacaatcgcgtg
gcgcacgctctgtgcagccacgtagaccaagctcagctgctgcacgccctggaggacgcg
cacctgccaggcccactgcgcgcaggctactatgacctcctcatcagcatccacctcgaa
agtgcctgccgcagccgccgctccatgctctctgaatacatcgtgcccctcacgcctgag
acccgcgccatcacgctcttccctcctggaaggagcacagaaaatggtcacccccggcat
ggcctgccgggagttggagtcaccacttcgctgaggcccccgcatcatttctcgcccccc
tgtttcgtggccgctctgccagctgctggggcagcagaggccccggcccgcctcagccct
gccatcccgctggaggccctgcgggacaaggcactgaggatgctgggggaggcggtgcgc
gacggtgggcagcacgctcgcgaccccgtcgggggctccgtggagttccagtttgtgcct
gtgctcaagctcgtgtccaccctgctggtgatgggcatctttggcgatgaggatgtgaaa
cagatcttgaagatgattgagcctgaggtcttcactgaggaagaagaggaggaggacgag
gaggaagagggtgaagaggaagatgaggaggagaaggaggaggatgaggaggaaacagca
caggaaaaggaagatgaggaaaaagaggaagaggaggcagcagaaggggagaaagaagaa
ggcttggaggaagggctgctccagatgaagttgccagagtctgtgaagttacagatgtgc
cacctgctggagtatttctgtgaccaagagctgcagcaccgtgtggagtccctggcagcc
tttgcggagcgctatgtggacaagctccaggccaaccagcggagccgctatggcctcctc
ataaaagccttcagcatgaccgcagcagagactgcaagacgtacccgcgagttccgctcc
ccaccccaggaacagatcaatatgctattgcaattcaaagatggtacagatgaggaagac
tgtcctctccctgaagagattcgacaggatttgcttgactttcatcaagacctgctggca
cactgtggaattcagctagatggagaggaggaggaaccagaggaagagaccaccctgggc
agccgcctcatgagcctgttggagaaagtgcggctggtgaagaagaaggaagagaaacct
gaggaggagcggtcagcagaggagagcaaaccccggtccctgcaggagctggtgtcccac
atggtggtgcgctgggcccaagaggacttcgtgcagagccccgagctggtgcgggccatg
ttcagcctcctgcaccggcagtacgacgggctgggtgagctgctgcgtgccctgccgcgg
gcgtacaccatctcaccgtcctccgtggaagacaccatgagcctgctcgagtgcctcggc
cagatccgctcgctgctcatcgtgcagatgggcccccaggaggagaacctcatgatccag
agcatcgggaacatcatgaacaacaaagtcttctaccaacacccgaacctgatgagggcg
ctgggcatgcacgagacggtcatggaggtcatggtcaacgtcctcgggggcggcgagtcc
aaggagatccgcttccccaagatggtgacaagctgctgccgcttcctctgctatttctgc
cgaatcagccggcagaaccagcgctccatgtttgaccacctgagctacctgctggagaac
agtggcatcggcctgggcatgcagggctccacgcccctggacgtggctgctgcctccgtc
attgacaacaatgagctggccttggcattgcaggagcaggacctggaaaaggttgtgtcc
tacctggcaggctgtggcctccagagctgccccatgcttgtggccaaagggtacccagac
attggctggaacccctgtggtggagagcgctacctggacttcctgcgctttgctgtcttc
gtcaacggcgagagcgtggaggagaacgccaatgtggtggtgcggctgctcatccggaag
cctgagtgcttcggacccgccctgcggggtgagggtggctcagggctgctggctgccatc
gaagaggccatccgcatctccgaggaccctgcgagggatggcccaggcatccgcagggac
cggcggcgcgagcactttggtgaggaaccgcctgaagaaaaccgggtgcacctgggacac
gccatcatgtccttctatgccgccttgatcgacctgctcggacgctgtgcaccagagatg
catctaatccaagccggcaagggtgaggccctgcggatccgcgccatcctccgctccctt
gtgcccttggaggaccttgtgggcatcatcagcctcccactgcagattcccaccctgggc
aaagatggggctctggtgcagccaaagatgtcagcatccttcgtgccggaccacaaggcg
tccatggtgctcttcctggaccgtgtgtatggcatcgagaaccaggacttcttgctgcac
gtgctggacgtggggttcctgcccgacatgagggcagccgcctcgctggacacggccact
ttcagcaccaccgagatggcgctggcgctgaaccgctacctgtgcctggccgtgctgccg
ctcatcaccaagtgtgcgccgctctttgcgggcacagaacaccgcgccatcatggtggac
tctatgctgcataccgtgtaccgcctgtctcggggtcgttcgctcaccaaggcgcagcgt
gacgtcatcgaggactgcctcatgtcgctctgcaggtacatccgcccgtcgatgctgcag
cacctgttgcgccgcctggtgttcgacgtgcccatcctcaacgagttcgccaagatgcca
ctcaagctcctcaccaaccactatgagcgctgttggaagtactactgcctacccacgggc
tgggccaacttcggggtcacctcagaggaggagctgcacctcacacggaaactcttctgg
ggcatctttgactctctggcccataagaaatacgacccggagctgtaccgcatggccatg
ccttgtctgtgcgccattgccggggctctgccccccgactatgtggatgcctcatactca
tctaaggcagagaaaaaggccacagtggatgctgaaggcaactttgatccccggcctgtg
gagaccctcaatgtgatcatcccggagaagctggactccttcattaacaagtttgcggag
tacacacacgagaagtgggccttcgacaagatccagaacaactggtcctatggagagaac
atagacgaggagctgaagacccaccccatgctgaggccctacaagaccttttcagagaag
gacaaagagatttaccgctggcccatcaaggagtccctgaaggccatgattgcctgggaa
tggacgatagagaaggccagggagggtgaggaggagaagacggaaaagaaaaaaacgcgg
aagatatcacaaagtgcccagacctatgatcctcgagaaggctacaaccctcagcccccc
gaccttagtgctgttaccctgtcccgggagctgcaggccatggcagaacaactggcagaa
aattaccacaacacgtggggacggaagaagaagcaggagctggaagccaaaggcggtggg
acccaccccctgctggtcccctacgacacgctcacggccaaggagaaggcacgagatcga
gagaaggcccaggagctactgaaattcctgcagatgaatggctacgcggttacaagaggc
cttaaggacatggaactggactcgtcttccattgaaaagcggtttgcctttggcttcctg
cagcagctgctgcgctggatggacatttctcaggagttcattgcccacctggaggctgtg
gtcagcagtgggcgagtggaaaagtccccacatgaacaggagattaaattctttgccaag
atcctgctccctttgatcaaccagtacttcaccaaccactgcctctatttcttgtccact
ccggctaaagtgctgggcagcggtggccacgcctctaacaaggagaaggaaatgatcacc
agcctcttctgcaaacttgctgctctcgtccgccaccgagtctctctctttgggacagac
gccccagctgtggtcaactgtcttcacatcctggcccgctccctggatgccaggacagtg
atgaagtcaggccctgagatcgtgaaggctggcctccgctccttcttcgagagtgcctcg
gaggacatcgagaagatggtggagaacctgcggctgggcaaggtgtcgcaggcgcgcacc
caggtgaaaggcgtgggccagaacctcacctacaccactgtggcactgctgccggtcctc
accaccctcttccagcacatcgcccagcaccagttcggagatgacgtcatcctggacgac
gtccaggtctcttgctaccgaacgctgtgcagtatctactccctgggaaccaccaagaac
acttatgtggaaaagcttcggccagccctcggggagtgcctggcccgtctggcagcagcc
atgccggtggcgttcctggagccgcagctgaacgagtacaacgcctgctccgtgtacacc
accaagtctccgcgggagcgggccatcctggggctccccaacagtgtggaggagatgtgt
cccgacatcccggtgctggagcggctcatggcagacattggggggctggccgagtcaggt
gcccgctacacagagatgccgcatgtcatcgagatcacgctgcccatgctatgcagctac
ctgccccgatggtgggagcgcgggcccgaggcacccccttccgccctgcccgccggcgcc
cccccaccctgcacagctgtcacctctgaccacctcaactccctgctggggaatatcctg
agaatcatcgtcaacaacctgggcattgacgaggcctcctggatgaagcggctggctgtg
ttcgcacagcccattgtgagccgtgcacggccggagctcctgcagtcccacttcatccca
actatcgggcggctgcgcaagagggcagggaaggtggtgtccgaggaggagcagctgcgc
ctggaggccaaggcggaggcccaggagggcgagctgctggtgcgggacgagttctctgtg
ctctgccgggacctctacgccctgtatccgctgctcatccgctacgtggacaacaacagg
gcgcagtggctgacggagccgaatcccagcgcggaggagctgttcaggatggtgggcgag
atcttcatctactggtccaagtcccacaacttcaagcgcgaggagcagaactttgtggtc
cagaatgagatcaacaacatgtccttcctgactgctgacaacaaaagcaaaatggctaag
gcgggagatatacagtccggtggctcggaccaggaacgcaccaagaagaagcgccggggg
gaccggtactctgtgcagacgtcactgatcgtggccacactgaagaagatgctgcccatc
ggcctgaatatgtgtgcgcccaccgaccaagacctcatcacgctggccaagacccgttac
gccctgaaagacacagatgaggaggtccgggaatttctgcacaacaaccttcaccttcag
ggaaaggtcgaaggctccccgtctctgcgctggcagatggctctgtaccggggcgtcccg
ggtcgcgaggaggacgccgatgaccccgagaaaatcgtgcgcagagtccaggaagtgtca
gccgtgctctactacctggaccagaccgagcacccttacaagtctaagaaggccgtgtgg
cacaagcttttgtccaaacagcgccggcgggcagtcgtggcctgtttccgtatgacgccc
ctgtacaacctgcccacgcaccgggcatgtaacatgttcctggagagctacaaggctgca
tggatcctgactgaagaccacagttttgaggaccgcatgatagatgacctttcaaaagct
ggggagcaggaggaggaggaggaagaggtggaagagaagaagccagaccccctgcaccag
ttggtcctgcacttcagccgcactgccctgacggaaaagagcaaactggatgaggattac
ctgtacatggcctatgctgatatcatggcaaagagctgccacctggaggagggaggggag
aacggtgaagctgaagaggaggttgaggtctcctttgaggagaaacagatggagaagcag
aggctcttgtaccagcaagcacggctgcacacccggggggcggccgagatggtgctgcag
atgatcagtgcctgcaaaggagagacaggtgccatggtgtcctccaccctgaagctgggc
atctccatcctcaatggaggcaatgctgaggtccagcagaaaatgctggattatcttaag
gacaagaaggaagttggcttcttccagagtatccaggcactgatgcaaacatgcagcgtc
ctggatctcaatgcctttgagagacagaacaaggccgaggggctgggcatggtgaatgag
gatggcactgtcatcaatcgccagaacggagagaaggtcatggcggatgatgaattcaca
caagacctgttccgattcctacaattgctctgtgaggggcacaataatgatttccagaac
tacctacggacacagacagggaacacgaccactattaacatcatcatttgcactgtggac
tacctcctgcggctgcaggaatccatcagcgacttctactggtactactcgggcaaggat
gtcattgaagagcagggcaagaggaacttctccaaagccatgtcggtggctaagcaggtg
ttcaacagcctcactgagtacatccagggtccctgcaccgggaaccagcagagcctggcg
cacagtcgcctatgggacgcagtggtgggattcctgcacgtgttcgcccacatgatgatg
aagctcgctcaggactcaagccagatcgagctgctgaaggagctgctggatctgcagaag
gacatggtggtgatgttgctgtcgctactagaagggaacgtggtgaacggcatgatcgcc
cggcagatggtggacatgctcgtggaatcctcatccaatgtggagatgatcctcaagttc
ttcgacatgttcctgaaactcaaggacattgtgggctctgaagccttccaggactacgta
acggatccccgtggcctcatctccaagaaggacttccagaaggccatggacagccagaag
cagttcagcggtccagaaatccagttcctgctttcgtgctccgaagcggatgagaacgaa
atgatcaactgcgaagagttcgccaaccgcttccaggagccagcacgcgacatcggcttc
aacgtggcggtgctgctgaccaacctgtcggagcatgtgccgcatgaccctcgcctgcac
aacttcctggagctggccgagagcatccttgagtacttccgcccctacctgggccgcatc
gagatcatgggcgcgtcacgccgcatcgagcgcatctacttcgagatctcagagaccaac
cgcgcccagtgggagatgccccaggtgaaggagtccaagcgccagttcatcttcgacgtg
gtgaacgagggcggcgaggctgagaagatggagctcttcgtgagtttctgcgaggacacc
atcttcgagatgcagatcgccgcgcagatctcggagcccgagggcgagccggagaccgac
gaggacgagggcgcgggcgcggcggaggcgggcgcggaaggcgcggaggagggcgcggcg
gggctcgagggcacggcggccacggcggcggcgggggcgacggcgcgggttgtggcggcc
gcaggccgggccctgcgaggcctcagctaccgcagcctgcggcggcgcgtgcggcggctg
cggcggcttacggcccgcgaggcggccaccgcagtggcggcgctgctctgggcagcagtg
acgcgcgctggggccgctggcgcgggggcggcggcgggcgcgctgggcctgctctggggc
tcgctgttcggcggcggcctggtggagggcgccaagaaggtgacggtgaccgagctcctg
gcaggcatgcccgaccccaccagcgacgaggtgcacggcgagcagccggccgggccgggc
ggagacgcagacggcgagggtgccagcgagggcgctggagacgccgcggagggcgctgga
gacgaggaggaggcggtgcacgaggccgggccgggcggtgccgacggggcggtggccgtg
accgatgggggccccttccggcccgaaggggctggcggtctcggggacatgggggacacg
acgcctgcggaaccgcccacacccgagggctctcccatcctcaagaggaaattgggggtg
gatggagtggaggaggagctcccgccagagccagagcccgagccggaaccagagctggag
ccggagaaagccgatgccgagaatggggagaaggaagaagttcccgagcccacaccagag
ccccccaagaagcaagcacctccctcaccccctccaaagaaggaggaagctggaggcgaa
ttctggggagaactggaggtgcagagggtgaagttcctgaactacctgtcccggaacttt
tacaccctgcggttccttgccctcttcttggcatttgccatcaacttcatcttgctgttt
tataaggtctcagactctccaccaggggaggacgacatggaaggctcagctgctggggat
gtgtcaggtgcaggctctggtggcagctctggctggggcttgggggccggagaggaggca
gagggcgatgaggatgagaacatggtgtactacttcctggaggaaagcacaggctacatg
gaacccgccctgcggtgtctgagcctcctgcatacactggtggcctttctctgcatcatt
ggctataattgtctcaaggtgcccctggtaatctttaagcgggagaaggagctggcccgg
aagctggagtttgatggcctgtacatcacggagcagcctgaggacgatgacgtgaagggg
cagtgggaccgactggtgctcaacacgccgtctttccctagcaactactgggacaagttt
gtcaagcgcaaggtcctggacaaacatggggacatctacgggcgggagcggattgctgag
ctactgggcatggacctggccacactagagatcacagcccacaatgagcgcaagcccaac
ccgccgccagggctgctgacctggctcatgtccatcgatgtcaagtaccagatctggaag
ttcggggtcatcttcacagacaactccttcctgtacctgggctggtatatggtgatgtcc
ctcttgggacactacaacaacttcttctttgctgcccatctcctggacatcgccatgggg
gtcaagacgctgcgcaccatcctgtcctctgtcacccacaatgggaaacagctggtgatg
accgtgggccttctggcggtggtcgtctacctgtacaccgtggtggccttcaacttcttc
cgcaagttctacaacaagagcgaggatgaggatgaacctgacatgaagtgtgatgacatg
atgacgtgttacctgtttcacatgtacgtgggtgtccgggctggcggaggcattggggac
gagatcgaggaccccgcgggtgacgaatacgagctctacagggtggtcttcgacatcacc
ttcttcttcttcgtcatcgtcatcctgttggccatcatccagggtctgatcatcgacgct
tttggtgagctccgagaccaacaagagcaagtgaaggaggatatggagaccaagtgcttc
atctgtggaatcggcagtgactactttgatacgacaccgcatggcttcgagactcacacg
ctggaggagcacaacctggccaattacatgtttttcctgatgtatttgataaacaaggat
gagacagaacacacgggtcaggagtcttatgtctggaagatgtaccaagagagatgttgg
gatttcttcccagctggtgattgtttccgtaagcagtatgaggaccagcttagctga

KEGG   Homo sapiens (human): 6262Help
Entry
6262              CDS       T01001                                 

Gene name
RYR2, ARVC2, ARVD2, RYR-2, RyR, VTSIP
Definition
(RefSeq) ryanodine receptor 2
  KO
K04962  ryanodine receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04371  Apelin signaling pathway
hsa04713  Circadian entrainment
hsa04911  Insulin secretion
hsa04921  Oxytocin signaling pathway
hsa04972  Pancreatic secretion
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Disease
H00293  Arrhythmogenic right ventricular cardiomyopathy
H01019  Catecholaminergic polymorphic ventricular tachycardia
Drug target
Aladorian (DG02040): D10304 D10305
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    6262 (RYR2)
   04020 Calcium signaling pathway
    6262 (RYR2)
   04024 cAMP signaling pathway
    6262 (RYR2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    6262 (RYR2)
   04921 Oxytocin signaling pathway
    6262 (RYR2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    6262 (RYR2)
   04261 Adrenergic signaling in cardiomyocytes
    6262 (RYR2)
  09154 Digestive system
   04972 Pancreatic secretion
    6262 (RYR2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    6262 (RYR2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    6262 (RYR2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    6262 (RYR2)
   05414 Dilated cardiomyopathy (DCM)
    6262 (RYR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    6262 (RYR2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ryanodine receptor
   6262 (RYR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_8 EF-hand_7 EF-hand_1 EF-hand_6
Motif
Other DBs
NCBI-GeneID: 6262
NCBI-ProteinID: NP_001026
OMIM: 180902
HGNC: 10484
Ensembl: ENSG00000198626
Vega: OTTHUMG00000039543
Pharos: Q92736(Tclin)
UniProt: Q92736
LinkDB All DBs
Structure
PDB: 

Position
1q43
AA seq 4967 aa AA seqDB search
MADGGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPP
DLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGGGHRTLLYGHAIL
LRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDD
LILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGH
MDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHV
TTGKYLSLMEDKNLLLMDKEKADVKSTAFTFRSSKEKLDVGVRKEVDGMGTSEIKYGDSV
CYIQHVDTGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHMDDGISLSRSQHEESRTARVIR
STVFLFNRFIRGLDALSKKAKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLR
ALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAAL
IRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISL
LDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIF
LGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGD
DLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFE
NFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREY
KQERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIEL
GWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEDK
VKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGI
QQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSG
TGERFRIFRAEKTYAVKAGRWYFEFETVTAGDMRVGWSRPGCQPDQELGSDERAFAFDGF
KAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDG
FIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQ
VPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSNTDIMFYRLSMPIECAEVFSKTVAG
GLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEK
PSRLKQRFLLRRTKPDYSTSHSARLTEDVLADDRDDYDFLMQTSTYYYSVRIFPGQEPAN
VWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGR
NNNGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRI
KNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQ
CLDPLQFMSLHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHV
DEPQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEYIVPMTEETKSITLFP
DENKKHGLPGIGLSTSLRPRMQFSSPSFVSISNECYQYSPEFPLDILKSKTIQMLTEAVK
EGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAATPEEE
SDTLEKELSVDDAKLQGAGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRH
RIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFK
DDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGNSDLTIRGRLLSLVEKVTYLK
KKQAEKPVESDSKKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVR
ALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPN
LMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSY
LLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQML
VSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGG
NGLLAAMEEAIKIAEDPSRDGPSPNSGSSKTLDTEEEEDDTIHMGNAIMTFYSALIDLLG
RCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGNVVEPDMSAGF
CPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYL
CTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQL
RPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHL
SRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGN
FNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPY
KLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHG
YSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKMELESKGGGNHPLLVPYDTLTAK
EKAKDREKAQDILKFLQINGYAVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYI
LEFDGGSRGKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKE
KEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKSALRAF
LDNAAEDLEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGED
LILEDVQVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLDKHNI
YSIYNTKSSRERAALSLPTNVEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVILP
MLCSYMSRWWEHGPENNPERAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLA
VFSQPIINKVKPQLLKTHFLPLMEKLKKKAATVVSEEDHLKAEARGDMSEAELLILDEFT
TLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFV
VQNEINNMSFLITDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNI
CAPGDQELIALAKNRFSLKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTDD
TSDPEKTVERVLDIANVLFHLEQKSKRVGRRHYCLVEHPQRSKKAVWHKLLSKQRKRAVV
ACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAEPPEEDEGTKR
VDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEEKEME
KQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDY
LKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLF
RFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDE
QGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQ
DSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMF
LKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDY
EEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMG
SAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEM
QLAAQISESDLNERSANKEESEKERPEEQGPRMAFFSILTVRSALFALRYNILTLMRMLS
LKSLKKQMKKVKKMTVKDMVTAFFSSYWSIFMTLLHFVASVFRGFFRIICSLLLGGSLVE
GAKKIKVAELLANMPDPTQDEVRGDGEEGERKPLEAALPSEDLTDLKELTEESDLLSDIF
GLDLKREGGQYKLIPHNPNAGLSDLMSNPVPMPEVQEKFQEQKAKEEEKEEKEETKSEPE
KAEGEDGEKEEKAKEDKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFY
NMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRSSSENAKVTSLDSSSHRIIAVHYV
LEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQ
PSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFS
DAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFA
AHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGD
TPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLA
IIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLF
FLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
NT seq 14904 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgggggcgagggcgaagacgagatccagttcctgcgaactgatgatgaagtg
gttctgcagtgcaccgcaaccatccacaaagaacaacagaagctatgcttggcagcagaa
ggatttggcaacagactttgtttcttggagtccacttccaattccaagaatgtgccccca
gacctctccatctgcacctttgtgctggagcagtccctctctgtccgggcgctgcaggag
atgctggctaacaccgtggagaaatcagaagggcaagttgatgtggaaaaatggaaattc
atgatgaagactgctcaaggtggtggtcatcgaacactcctctacggacatgccatattg
ctgcgccattcctatagtggcatgtatctgtgctgcctgtccacctcccggtcttcaact
gataagctggcttttgatgttggcttgcaagaggacaccacaggggaggcttgttggtgg
accatacaccctgcctctaagcagcgatcagaaggagaaaaagtacgagttggagatgac
ctcatcttagttagcgtgtcctctgaaaggtacttgcacttgtcttatggcaacggcagc
ttacacgtggatgccgctttccagcagactctctggagcgtggccccaatcagctcagga
agtgaggcagcccaagggtatctcattggtggtgatgtcctcaggttgctgcatggacac
atggacgagtgtctcactgtcccttcaggagaacatggtgaagagcagcggagaactgtt
cattatgaaggtggcgctgtgtctgttcatgcacgttccctttggagactagagacgcta
agagttgcgtggagtggaagccacataagatggggacagccattccgactacgccatgtc
acaacaggaaaatacttgagtctcatggaagacaaaaaccttctactcatggacaaagag
aaagctgatgtaaaatcaacagcatttaccttccggtcttccaaggaaaaattggatgta
ggggtgagaaaagaagtagatggcatgggaacatctgaaataaaatacggtgactcagta
tgctatatacaacatgtagacacaggcctatggcttacttaccagtctgtggacgtgaaa
tccgtgagaatgggatctatacaacgtaaggctattatgcatcatgaaggccacatggat
gatggcataagtttgtcgagatcccagcatgaagaatcacgcacagcccgagttatccgg
agcacagtcttccttttcaatagatttataaggggccttgatgctctcagcaagaaagcg
aaggcttccacagtcgatttgcctatagagtccgtaagcctaagtctgcaggatctcatt
ggctacttccaccccccagatgagcatttagagcatgaagacaaacagaacagactacga
gccctgaagaatcggcaaaatctcttccaggaagagggaatgatcaacctcgtgcttgag
tgcatagaccgtttgcacgtctacagcagtgcagcacactttgctgatgttgctgggcga
gaagcaggagagtcttggaaatccattctgaattctctgtatgagttgctggcggctcta
attagaggaaatcgtaaaaactgtgctcaattttctggctccctcgactggttgatcagc
agattggaaagactggaagcttcttcaggcattctggaagttttacactgtgttttagta
gaaagtccagaagctctaaatattattaaagaaggacatattaaatctattatctcactt
ttagacaaacatggaagaaatcacaaggttctggatgtcttgtgctcactctgtgtttgc
cacggggttgcagtccgttctaaccagcatctcatctgtgacaatctcctaccaggaaga
gacttgttattgcagacacgtcttgtgaaccatgtcagcagcatgagacccaatattttt
ctgggcgtcagtgaaggttctgctcagtataagaaatggtactatgaattgatggtggac
cacacagagccctttgtgacagctgaagcaactcacctgcgagtgggctgggcttccact
gaaggatattctccctaccctggagggggcgaagagtggggtggaaatggtgttggagat
gatctcttctcctatggatttgatggccttcatctctggtcaggttgtattgctcgtact
gtaagctcaccaaaccaacatctgttaagaactgatgatgtcatcagttgctgtttagat
ctgagtgccccaagcatctcgttccgaattaatggacaacctgttcaaggaatgtttgag
aatttcaacatcgatggcctcttctttccagtcgttagtttctctgcaggaataaaagta
cgctttctgcttggagggcgacatggagaattcaaatttcttcctccacctgggtatgct
ccttgttatgaagctgttctgccaaaagaaaagttgaaagtggaacacagccgagagtac
aagcaagaaagaacttacacacgcgacctgctgggccccacagtttccctgacgcaagct
gccttcacacccatccctgtggataccagccagatcgtgttgcctcctcatctagaaaga
ataagagaaaaactggcagagaatatccatgaactctgggttatgaataaaattgagctt
ggctggcagtatggtccggttagagatgacaacaagagacaacacccatgcctggtggag
ttctccaagctgcctgaacaggagcgcaattacaacttacaaatgtcgcttgagaccctg
aagactttgttggcattaggatgtcatgtgggtatatcagatgaacatgctgaagacaag
gtgaaaaaaatgaagctacccaagaattaccagctgacaagtggatacaagcctgcccct
atggacctgagctttatcaaactcaccccatcacaagaagcaatggtggacaagttggca
gaaaatgcacataatgtgtgggcgcgggatcgaatccggcagggctggacttatggcatc
caacaggacgtaaagaacagaagaaatcctcgccttgttccctacactcttctggatgac
cgaaccaagaaatccaacaaggacagcctccgcgaggctgtgcgcacgctgctggggtac
ggctacaacttggaagcaccagatcaagatcatgcagccagagccgaagtgtgcagcggc
accggggaaaggttccgaatcttccgtgccgagaagacctatgcagtgaaggccggacgg
tggtattttgaatttgagacggtcactgctggagacatgagggttggttggagtcgtcct
ggttgtcaaccggatcaggagcttggctcagatgaacgtgcctttgcctttgatggcttc
aaggcccagcggtggcatcagggcaatgaacactatgggcgctcttggcaagcaggcgat
gtcgtggggtgtatggttgacatgaacgaacacaccatgatgttcacactgaatggtgaa
atccttcttgatgattcaggctcagaactggctttcaaggactttgatgttggcgatgga
ttcatacctgtgtgtagccttggagtggctcaagtgggtaggatgaactttggaaaggat
gtcagcaccttgaaatatttcaccatctgtggcttacaagagggctatgaaccatttgcc
gttaatacaaacagggatattaccatgtggctgagcaagaggcttcctcagtttcttcaa
gttccatcaaaccatgaacatatagaggtgaccagaatagacggcaccatagacagttcc
ccatgtttaaaggtcactcagaagtcttttggttctcagaacagcaacactgatatcatg
ttttatcgcctgagcatgccgatcgagtgcgcggaggtcttctccaagacggtggctgga
gggctccctggggctggcctttttgggcccaagaatgacttggaagattatgatgctgat
tctgactttgaggttctgatgaagacagctcatggccatctagtgcccgatcgtgttgac
aaagacaaagaagctactaaaccagagtttaacaaccacaaagattatgcccaggaaaag
ccctctcgtctgaaacaaagatttttgcttagaagaacaaagccagattacagcacaagc
cattctgcaagactcaccgaagatgtccttgctgatgatcgggatgactatgatttcttg
atgcaaacgtccacgtactattactcagtgagaatctttcctggacaagaacctgctaat
gtctgggtgggctggattacatcagatttccatcagtatgacacaggctttgacttggac
agagttcgcacagtaacagttactctaggagatgaaaaaggaaaagtgcatgaaagcatc
aaacgcagcaactgctatatggtatgtgcgggtgagagcatgagccccgggcaaggacgc
aacaataatggactggagattggctgtgtggtggatgctgccagcgggctgctcacattc
attgccaatggcaaggaactgagcacatactatcaggtggaaccgagtacaaaattattt
cctgcggtttttgcacaagctacaagtcccaatgttttccagtttgagttgggaagaata
aagaatgtgatgcctctctcggcgggattattcaagagtgagcacaagaaccccgtgccg
cagtgccccccgcgcctccacgtgcagttcctgtcacacgtcctgtggagcagaatgccc
aaccagtttttgaaggtagatgtgtctcgaataagtgaacgccaaggctggttggtgcag
tgtttggatcctctgcagttcatgtctcttcatatccctgaggaaaacagatctgttgac
atcttagagttgacagagcaggaggaattgctgaaatttcactatcacactctccggctc
tactcagccgtctgtgctcttgggaaccaccgggtggcccatgccctgtgcagccatgtg
gatgaacctcagctcctctatgccattgagaacaagtacatgcctggtttgctgcgtgct
ggctactatgacctgctgattgacatccacctgagctcctatgccactgccaggctcatg
atgaacaacgagtacattgtccccatgacggaggagacgaagagcatcaccctgttccct
gatgagaacaaaaaacacggccttccagggatcggcctcagcacctccctcaggccacgg
atgcagttttcctcccccagttttgtaagcattagtaatgaatgttaccagtacagtcca
gagttcccactggacatcctcaagtccaaaaccatacagatgctgacagaagctgttaaa
gagggcagtcttcatgcccgggacccagttggagggactactgaattcctctttgtacct
ctcatcaagcttttctataccctgctgatcatgggcatctttcacaacgaggacttgaag
cacatcttgcagttgattgagcccagtgtgtttaaagaagctgccactccggaggaggag
agtgacacgctggagaaagagctcagtgtggacgatgcaaagctgcaaggagctggtgag
gaagaagccaaggggggcaagcggcccaaggaaggcctgctccaaatgaaactgccagag
ccagttaaattgcagatgtgcctactgcttcagtacctctgtgactgccaggtccggcac
cggatagaagccattgtagccttttcagatgattttgtggctaagctccaagacaatcaa
cgtttccgatacaacgaagtcatgcaagccttaaacatgtcagctgcactcacagccagg
aagacaaaggaatttagatcaccacctcaagaacagatcaatatgcttctcaattttaag
gatgacaaaagtgaatgtccatgtccagaagaaattcgtgaccaactattggatttccat
gaagatttgatgacacattgtggaattgagctggatgaagatgggtctctggatggaaac
agtgatttaacaattagagggcgtctgctatccctggtagaaaaggtgacatatctgaag
aagaagcaagcagaaaaaccagttgagagtgactccaaaaagtcctccactctgcagcag
ctgatttctgagaccatggtccgatgggctcaggagtctgtcattgaagaccccgagctg
gtgagggccatgtttgtgttgctccatcggcagtatgacggcattgggggtcttgttcgg
gccctgccaaagacctacacgataaatggtgtgtccgtggaggacaccatcaacctgctg
gcatcccttggtcagattcggtccctgctgagtgtgagaatgggcaaagaagaagagaag
ctcatgattcgtggattaggggatattatgaataacaaagtgttttaccagcaccctaat
ctcatgagggcactggggatgcacgagactgtgatggaggtcatggtgaacgtccttgga
ggtggagagtccaaggaaatcacctttcccaagatggtggccaactgttgccgttttctc
tgttacttctgtcgtataagtaggcagaatcaaaaagctatgtttgatcatctcagttat
ttactggaaaacagcagtgttggtcttgcctccccagctatgagaggttcaacaccactg
gatgtggctgcagcttcggtgatggataataatgaactagcattagctctgcgtgagccg
gatctagaaaaggtagttcgttatttggctggttgtggactgcaaagttgccagatgctg
gtgtctaagggctatccagacattgggtggaacccagttgaaggagagagatatcttgac
tttcttagatttgctgtcttctgtaatggggagagtgtggaggaaaatgcaaatgtcgtg
gtgagattgctcattcggaggcctgagtgttttggtcctgctttgagaggagaaggtggg
aatgggcttcttgcagcaatggaagaagccatcaaaatcgccgaggatccttcccgagat
ggtccctcaccaaatagcggatccagtaaaacacttgacacagaggaggaggaagatgac
actatccacatggggaacgcgatcatgaccttctattcagctttgattgacctcttggga
cgctgtgctcctgagatgcatttgattcatgccgggaagggagaagccatcagaattagg
tccattttgagatccctcattcccctgggagatttggtgggcgttatcagcatcgctttt
cagatgccaacaatagccaaagatgggaatgtggtggaacctgacatgtctgcggggttt
tgcccagatcacaaggcagccatggttttattccttgacagggtctatgggattgaggtt
caagacttcctcctccatcttcttgaggttggctttctgccagatctccgggcggctgct
tctttagatacggcagctttgagtgctacagacatggccttggccctcaatcggtacctt
tgcacagccgtcttgccattgttaacaagatgtgctcctctctttgctggcacagagcac
cacgcttctctcattgactcattacttcatactgtgtatagactttctaagggctgttca
cttaccaaagctcagcgggattccatagaagtttgtttactctctatttgtggacaactg
agaccttctatgatgcagcacttactcagaagattagtatttgatgttccattattaaat
gaacacgcaaagatgcctcttaaactgctgacaaatcattatgaaagatgctggaaatat
tactgcctgcctggagggtggggaaactttggtgctgcctcagaagaagaacttcattta
tcaagaaagttgttctggggcatttttgatgccctgtctcaaaagaaatatgaacaagaa
cttttcaaactggcactgccttgcctgagtgcagttgcgggagctttgcctccagactac
atggagtcaaattatgtcagtatgatggaaaaacagtcatcaatggattctgaagggaac
tttaacccacaacctgttgatacctcaaatattacaattcctgagaaattggaatacttc
attaacaaatatgcagaacactcccatgacaaatggtcaatggacaagttggcaaatgga
tggatttatggagaaatatattcagactcttctaaggttcagccattaatgaagccatat
aagctattgtctgaaaaggaaaaagaaatttatcgctggccaatcaaagaatctttaaaa
actatgctggcttggggctggagaattgaaagaactcgggagggagacagcatggccctt
tacaaccggactcgtcgtatttctcagacaagccaggtttctgtggacgctgcccatggt
tacagtccccgggccattgacatgagcaatgttacactatctagagacctgcatgctatg
gcagaaatgatggctgaaaactaccataatatatgggcaaagaaaaagaaaatggagttg
gagtccaaaggaggaggaaaccatcctctgctggtgccctatgatacactgacagccaaa
gagaaagccaaggatagagaaaaagcacaggacatcctcaagttcttgcagatcaatgga
tatgctgtatccagaggatttaaggacctggaactggacacgccttctattgagaaacga
tttgcctatagtttcctccaacaactcattcgctatgtggatgaagcccatcagtatatc
ctggagtttgatggtggcagcagaggcaaaggagaacatttcccttatgaacaagaaatc
aagttctttgcaaaagtcgttcttcctttaattgatcagtatttcaaaaaccatcgttta
tacttcttatctgcagcaagcagacctctctgctctggaggacatgcttccaacaaagag
aaagaaatggtgactagcctattctgcaaacttggagttcttgtcaggcataggatttca
ctatttggcaatgatgcaacatcaattgtcaactgtcttcatattttgggtcagactttg
gatgcaaggacagtgatgaagactggcctggagagtgttaaaagtgcactcagagctttt
ctggacaacgctgcagaggatctggagaagaccatggaaaacctcaagcagggccagttc
actcacacccgaaaccagcccaaaggggttactcagattatcaattacaccacagtggcc
ctgctgccaatgctgtcttcattatttgaacatattggccagcatcagttcggagaagac
ctaatattggaagatgtccaggtgtcttgttatagaattctgactagcttatatgctttg
ggaaccagcaagagtatttacgtggagaggcaacgttctgcattaggagaatgtctagct
gcctttgctggtgcttttcctgtagcatttttggaaactcatctggacaaacataatatt
tactccatctacaataccaagtcttcacgagaaagagcagctctcagtttgccaactaat
gtggaagatgtttgtccaaacataccgtctttggagaaactcatggaagaaatcgtggaa
ttagccgagtccggcattcgctacactcaaatgccacatgtcatggaagtcatactgccc
atgctttgcagctacatgtctcgttggtgggagcatggacctgagaacaatccagaacgg
gccgagatgtgctgcacagccctgaactcagagcacatgaacacacttctagggaacata
ttgaaaatcatatataataacttggggattgatgagggagcctggatgaagaggctagca
gtgttttcccagcctataataaataaagtgaaacctcagctcttgaaaactcatttcttg
ccgttaatggagaaactcaagaaaaaggcagctacggtggtgtctgaggaagaccacctg
aaagctgaggccaggggggacatgtcggaggcagaactcctcatcctagatgagttcacc
acactggccagagatctctatgccttctaccctctcttgattagatttgtggactataac
agggcaaagtggctaaaggagcctaacccagaagcagaggagctcttccgcatggtggct
gaagtgtttatctactggtcgaagtcccataatttcaaaagagaagagcagaacttcgtt
gtacagaatgaaatcaacaatatgtctttccttattactgataccaagtcaaagatgtca
aaggcagctgtttctgatcaggaaaggaagaaaatgaagcgcaaaggagatcggtattcc
atgcagacctctctgattgtagcagctctgaagcggttactgcccattgggttgaacatc
tgtgcccctggggaccaggagctcattgctctggccaaaaatcgatttagcctgaaagat
accgaggatgaagtacgagatataatccgcagcaatattcatttacaaggcaagttggag
gatcctgctattagatggcaaatggctctttacaaagacttaccaaacaggactgatgat
acctcagatccagagaagacggtagaaagagtattggatatagcaaatgtgctttttcat
cttgaacagaagtctaaacgtgtgggtcggagacattactgtctggtggaacatcctcag
agatctaaaaaggctgtatggcataaactactgtccaagcagaggaaaagggctgttgta
gcctgcttccggatggcccccttatataatctgccaaggcatcgggctgtcaatctcttt
cttcagggatatgaaaagtcttggattgaaacagaagaacattactttgaagataaactg
atagaagatttagcaaaacctggggctgaacctccagaagaagatgaaggcactaagaga
gttgatcctctacatcagctgatccttctgtttagtcggacagctttaacagagaaatgc
aaactggaggaagattttttatatatggcctatgcagatattatggcaaagagttgtcat
gatgaggaagatgacgatggtgaagaggaagtgaagagttttgaagaaaaagaaatggaa
aagcaaaagcttctataccagcaagcccgactccacgatcgtggcgcggctgagatggtg
ctacagacaatcagtgccagcaaaggtgaaactggaccaatggtagcagctactctgaaa
cttggaattgctattttaaatggtgggaactccacagtacagcagaaaatgcttgactac
ctcaaggagaaaaaggatgtgggcttctttcagagcctggccggcctgatgcagtcatgt
agtgtccttgacctaaatgcatttgagcgacaaaacaaagctgaaggtcttgggatggtg
acagaggaaggatcaggagaaaaggttctgcaggacgatgagttcacctgtgacctcttc
cgattcctgcaactactctgtgagggacacaactcagattttcagaattatctgagaact
cagactggcaataatacaactgtcaacataattatctccactgtagactacctactgaga
gttcaggaatcaattagtgacttttattggtattactctgggaaagatgttattgatgaa
caaggacaacggaatttctccaaagctatccaagtggcaaaacaagtctttaacactctt
acagagtatattcagggtccttgcactgggaatcaacagagtttggcacacagcaggctg
tgggatgctgtggtcggctttcttcatgtgtttgcccatatgcagatgaagctgtcgcag
gattccagtcaaattgagctattaaaagaattaatggatctgcagaaggatatggtggtc
atgttgctgtccatgttagaaggtaatgttgttaatggaacgattggcaaacagatggtg
gatatgcttgtggaatcttccaacaacgtggagatgattctcaaattttttgacatgttc
ttaaaactaaaggatttgacgtcgtctgatacttttaaagaatatgaccccgatggcaag
ggagtcatttccaagagggacttccacaaagcgatggagagccataagcactacacgcag
tcagaaacggaatttcttttgtcttgtgcggagacggatgagaatgaaaccctcgactac
gaagagttcgtcaaacgcttccacgaacctgcgaaggacatcggcttcaacgtcgccgtc
cttctgacaaacctctctgagcacatgcccaacgatacccgacttcagacttttctggaa
ttagcagagagcgtcctgaattatttccagccctttctgggccgcatcgaaatcatggga
agcgccaaacgcatcgagagggtctattttgaaatcagtgagtccagccgaacccagtgg
gagaagccccaggtcaaggagtccaaaagacagttcatatttgacgtggtcaacgaaggc
ggagagaaagagaagatggaactctttgtgaacttctgcgaggacaccatctttgaaatg
cagctggcggctcagatctcggagtcggacttgaacgagaggtcagcgaataaggaagaa
agcgagaaggagaggccggaagagcaggggccgaggatggctttcttctccattctgacg
gtcaggtcggccctgtttgcgctcaggtacaatatcttgacccttatgcgaatgctcagt
ctgaagagcctgaagaagcagatgaaaaaagtaaaaaagatgaccgtgaaggacatggtc
acggccttcttttcatcctactggagtattttcatgaccctcttgcacttcgtggccagc
gttttcagaggctttttccgcatcatttgcagcctgctgcttgggggaagcctcgtcgaa
ggtgctaaaaagatcaaagttgcagaactgttagccaacatgccagaccccactcaggat
gaggttagaggagatggggaggagggagagaggaaacccctggaagccgccctgccctcc
gaggatctgaccgacttaaaggagctgacagaggaaagtgaccttctttcggacatcttt
ggcctggatctgaagagagaaggaggacagtacaaactgattcctcataatccaaatgct
gggctcagtgacctcatgagcaacccagtccccatgcctgaggtgcaggaaaaatttcag
gaacagaaggcaaaagaagaagaaaaggaagaaaaagaagaaaccaaatctgaacctgaa
aaagccgagggagaagatggagaaaaagaagagaaagccaaggaagacaagggcaaacaa
aagttgaggcagcttcacacacacagatacggagaaccagaagtgccagagtcagcattc
tggaagaaaatcatagcatatcaacagaaacttctaaactattttgctcgcaacttttac
aacatgagaatgttagccttatttgtcgcatttgctatcaatttcatcttgctcttttat
aaggtctccacttcttctgtggttgaaggaaaggagctccccacgagaagttcaagtgaa
aatgccaaagtgacaagcctggacagcagctcccatagaatcatcgcagttcactatgta
ctagaggagagcagcggctacatggagcccacgttgcgtatcttagctattctgcacacg
gtcatttctttcttctgcatcattggatactactgcttgaaagtcccattggttattttt
aagcgagaaaaggaagtggcacggaaattggaatttgatgggctttatattacagaacag
ccttcagaagatgatattaaaggccagtgggatagactcgtaatcaacacacagtcattt
cccaacaactactgggacaaatttgttaaaagaaaggttatggataaatatggagagttc
tacggccgagacagaatcagtgaattacttggcatggacaaggcagctctggacttcagt
gatgccagagaaaagaagaagccaaagaaagacagctccttatcagctgtactgaactcc
attgatgtgaagtatcagatgtggaaactaggagtcgttttcactgacaactccttcctc
tacctagcctggtatatgactatgtctgttcttggacactataacaactttttttttgcc
gctcaccttctcgacattgctatgggattcaagacattaagaaccatcttgtcctcagta
actcacaatggcaaacagctcgtattaaccgttggcttattagctgttgttgtataccta
tacactgtggtggcattcaattttttccgaaaattctacaataaaagtgaagatggtgat
acaccagatatgaaatgtgacgatatgctaacatgctatatgttccacatgtatgttgga
gttcgtgctggaggagggatcggggatgaaatcgaagacccagcaggagatgaatatgag
atctatcgaatcatctttgacatcactttcttcttctttgttattgtcattctcttggcc
ataatacaaggtctaattattgatgcttttggagaactaagagaccaacaggaacaagtc
aaagaagacatggagaccaaatgcttcatctgtgggataggcaatgattacttcgacaca
gtgccacatggctttgaaacccacactttacaggagcacaacttggctaattacttgttt
tttctgatgtatcttataaacaaagatgaaacagaacacacaggacaggaatcttatgtc
tggaagatgtatcaagaaaggtgttgggaatttttcccagcaggggattgcttccggaaa
cagtatgaagaccagctaaattaa

KEGG   Homo sapiens (human): 6263Help
Entry
6263              CDS       T01001                                 

Gene name
RYR3, RYR-3
Definition
(RefSeq) ryanodine receptor 3
  KO
K04963  ryanodine receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04371  Apelin signaling pathway
hsa04713  Circadian entrainment
hsa04921  Oxytocin signaling pathway
hsa04970  Salivary secretion
hsa05010  Alzheimer disease
Network
nt06410  Calcium signaling
nt06460  Alzheimer disease
  Element
N01007  Mutation-caused aberrant PSEN to mGluR5-Ca2+ -apoptotic pathway
Drug target
Aladorian (DG02040): D10304 D10305
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    6263 (RYR3)
   04020 Calcium signaling pathway
    6263 (RYR3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    6263 (RYR3)
  09154 Digestive system
   04970 Salivary secretion
    6263 (RYR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    6263 (RYR3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    6263 (RYR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    6263 (RYR3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ryanodine receptor
   6263 (RYR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY MIR Ins145_P3_rec RIH_assoc Ion_trans EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 6263
NCBI-ProteinID: NP_001027
OMIM: 180903
HGNC: 10485
Ensembl: ENSG00000198838
Vega: OTTHUMG00000172253
Pharos: Q15413(Tclin)
UniProt: Q15413
LinkDB All DBs
Structure
PDB: 

Position
15q13.3-q14
AA seq 4870 aa AA seqDB search
MAEGGEGGEDEIQFLRTEDEVVLQCIATIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYIP
PDLCVCNFVLEQSLSVRALQEMLANTGENGGEGAAQGGGHRTLLYGHAVLLRHSFSGMYL
TCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSER
YLHLSVSNGNIQVDASFMQTLWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECLTIPSTD
QNDSQHRRIFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTED
QGLILQDRAKSDTKSTAFSFRASKELKEKLDSSHKRDIEGMGVPEIKYGDSVCFVQHIAS
GLWVTYKAQDAKTSRLGPLKRKVILHQEGHMDDGLTLQRCQREESQAARIIRNTTALFSQ
FVSGNNRTAAPITLPIEEVLQTLQDLIAYFQPPEEEMRHEDKQNKLRSLKNRQNLFKEEG
MLALVLNCIDRLNVYNSVAHFAGIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSN
NLDWLISKLDRLESSSGILEVLHCILTESPEALNLIAEGHIKSIISLLDKHGRNHKVLDI
LCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKW
YFELIIDQVDPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLW
SGRIPRAVASINQHLLRSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVMS
FSAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDADGIRDLLGT
TQFLSQASFIPCPVDTSQVILPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKR
QHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKLPKNYMMS
NGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLV
PYALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADSAVEKVSIDKIRFFRVERSY
AVRSGKWYFEFEVVTGGDMRVGWARPGCRPDVELGADDQAFVFEGNRGQRWHQGSGYFGR
TWQPGDVVGCMINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICCLGLSQIGR
MNLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKDHPHIEVMRID
GTMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEI
LSHTTTQCYYAIRIFAGQDPSCVWVGWVTPDYHLYSEKFDLNKNCTVTVTLGDERGRVHE
SVKRSNCYMVWGGDIVASSQRSNRSNVDLEIGCLVDLAMGMLSFSANGKELGTCYQVEPN
TKVFPAVFLQPTSTSLFQFELGKLKNAMPLSAAIFRSEEKNPVPQCPPRLDVQTIQPVLW
SRMPNSFLKVETERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMRFHYH
TLRLYSAVCALGNSRVAYALCSHVDLSQLFYAIDNKYLPGLLRSGFYDLLISIHLASAKE
RKLMMKNEYIIPITSTTRNIRLFPDESKRHGLPGVGLRTCLKPGFRFSTPCFVVTGEDHQ
KQSPEIPLESLRTKALSMLTEAVQCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDD
DDVRQILLLIDPSVFGEHSAGTEEGAEKEEVTQVEEKAVEAGEKAGKEAPVKGLLQTRLP
ESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTA
RKTKEFRSPPQEQINMLLNFQLGENCPCPEEIREELYDFHEDLLLHCGVPLEEEEEEEED
TSWTGKLCALVYKIKGPPKPEKEQPTEEEERCPTTLKELISQTMICWAQEDQIQDSELVR
MMFNLLRRQYDSIGELLQALRKTYTISHTSVSDTINLLAALGQIRSLLSVRMGKEEELLM
INGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGTEKSQIAFPKMVASCCRFLCYF
CRISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVMDNNELALSLEEPDLE
KVVTYLAGCGLQSCPMLLAKGYPDVGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKL
LIRRPECFGPALRGEGGNGLLAAMQGAIKISENPALDLPSQGYKREVSTGDDEEEEEIVH
MGNAIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLP
SLNKDGSVSEPDMAANFCPDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLD
TVSLSTTEAALALNRYICSAVLPLLTRCAPLFAGTEHCTSLIDSTLQTIYRLSKGRSLTK
AQRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLNEYCKMPLKLLTNHYEQCWKYYCL
PSGWGSYGLAVEEELHLTEKLFWGIFDSLSHKKYDPDLFRMALPCLSAIAGALPPDYLDT
RITATLEKQISVDADGNFDPKPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKY
GISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQRE
NEKLRSVSQANQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELESKGG
GSHPLLVPYDTLTAKEKFKDREKAQDLFKFLQVNGIIVSRGMKDMELDASSMEKRFAYKF
LKKILKYVDSAQEFIAHLEAIVSSGKTEKSPRDQEIKFFAKVLLPLVDQYFTSHCLYFLS
SPLKPLSSSGYASHKEKEMVAGLFCKLAALVRHRISLFGSDSTTMVSCLHILAQTLDTRT
VMKSGSELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPI
LTSIFEHVTQHQFGMDLLLGDVQISCYHILCSLYSLGTGKNIYVERQRPALGECLASLAA
AIPVAFLEPTLNRYNPLSVFNTKTPRERSILGMPDTVEDMCPDIPQLEGLMKEINDLAES
GARYTEMPHVIEVILPMLCNYLSYWWERGPENLPPSTGPCCTKVTSEHLSLILGNILKII
NNNLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLEKLKKKAVKTVQEEEQLKADG
KGDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRSNWLKSPDADSDQLFRMVAEVFI
LWCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKAMQVKSGGQDQERKKTKRRGDLY
SIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYSHRDTDEEVREHLRNNLHLQEKS
DDPAVKWQLNLYKDVLKSEEPFNPEKTVERVQRISAAVFHLEQVEQPLRSKKAVWHKLLS
KQRKRAVVACFRMAPLYNLPRHRSINLFLHGYQRFWIETEEYSFEEKLVQDLAKSPKVEE
EEEEETEKQPDPLHQIILYFSRNALTERSKLEDDPLYTSYSSMMAKSCQSGEDEEEDEDK
EKTFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMVVETLKLGIAILNGGN
AGVQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTLIVRE
RGEKVLQNDEFTRDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNVIISTVDYLLRLQES
ISDFYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAV
VGFLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLV
ESSTNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGIISKKEFQKAMEGQKQYTQSEID
FLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAES
VLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQE
KMELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDEDSSYVLEIAGEEEEDGSLEPAS
AFAMACASVKRNVTDFLKRATLKNLRKQYRNVKKMTAKELVKVLFSFFWMLFVGLFQLLF
TILGGIFQILWSTVFGGGLVEGAKNIRVTKILGDMPDPTQFGIHDDTMEAERAEVMEPGI
TTELVHFIKGEKGDTDIMSDLFGLHPKKEGSLKHGPEVGLGDLSEIIGKDEPPTLESTVQ
KKRKAQAAEMKAANEAEGKVESEKADMEDGEKEDKDKEEEQAEYLWTEVTKKKKRRCGQK
VEKPEAFTANFFKGLEIYQTKLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEE
ETEDVANLWNSFNDEEEEEAMVFFVLQESTGYMAPTLRALAIIHTIISLVCVVGYYCLKV
PLVVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVIN
KYGDLYGAERIAELLGLDKNALDFSPVEETKAEAASLVSWLSSIDMKYHIWKLGVVFTDN
SFLYLAWYTTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVV
VYLYTVVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGD
PYEMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDY
FDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDC
FRKQYEDQLG
NT seq 14613 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagggggagaaggaggcgaggacgagatccagtttctgaggactgaggatgaa
gtggtactccagtgcatcgccaccattcataaggagcagaggaagttctgcctggcagcc
gagggacttgggaatcgcctgtgcttcttggaacccacttcagaagccaagtacattcct
ccagatctctgcgtctgcaattttgtgctggaacagtccctatctgtcagagccctgcag
gaaatgcttgccaacacaggtgaaaatggcggcgaaggggcagcacaaggaggtggccac
aggaccctgttatacggccatgcagttctcctgaggcactctttcagcggaatgtatcta
acatgcttgactacatcaagatcccagacagacaaacttgcctttgatgtaggtctacgg
gaacatgccacaggagaagcctgttggtggactatacatcctgcttccaaacagaggtcc
gaaggagagaaagttcgaattggcgatgacctcatcctcgtcagcgtgtcctctgaaaga
taccttcatctctcagtatcaaatggtaacatacaagtggatgcctcctttatgcaaaca
ctctggaatgtacatcctacgtgctcaggaagtagcatcgaagaaggatacctacttggt
gggcatgtagtacgtcttttccatggtcatgatgaatgtttgacgataccatctacagac
cagaatgattcccagcacaggaggatattctacgaagctgggggagctgggactcgagcc
aggtctctttggagagtggaaccccttcggataagctggagtggcagtaacatcagatgg
ggccaggctttccgactccggcatctcaccacaggccactacctggccttgacagaagac
caaggccttatactgcaagaccgggcaaagtcagacaccaagtccacagctttctctttc
cgggcatcaaaggaactcaaggagaaattagactccagtcacaagcgagacatagaaggc
atgggagttccagaaatcaagtatggagattctgtctgctttgtgcagcatatagccagt
ggtctgtgggtgacctacaaagcacaagacgccaaaacttcccgcctgggacctctaaaa
agaaaggtcatactccatcaggaaggccacatggatgatggattaacactgcagagatgc
cagcgtgaggagtcccaggctgctcggatcatccggaacactacagccttattcagccag
tttgtcagcggaaacaatcgcacagctgcccccatcaccctgcctatagaagaagtcctg
cagaccctacaggacttgatcgcctacttccagcccccagaggaggagatgcgacatgaa
gacaagcagaacaagctccgctcactcaaaaacagacaaaatcttttcaaggaagaggga
atgttggcccttgtcttaaattgcattgaccgcttaaatgtctacaatagcgtagcacac
tttgcagggattgcaagggaagagagtggcatggcctggaaagaaattctgaacctcctc
tacaaattgctggctgctctcattcgcggaaacagaaacaattgcgctcaattctccaat
aaccttgattggctcatcagtaaattggacagactagaatcttcctcaggtatcttggaa
gttttgcactgcatcttaactgaaagcccagaagccttaaatctgatagcggagggccac
atcaagtcgatcatctccctgttggataagcacgggcggaatcacaaggttctggatatc
ctgtgctccctctgtctctgcaatggggttgcagtgagagccaaccagaatctgatctgt
gacaacttgctgccccggagaaacctactcctgcagacacgactgattaacgatgtaacc
agtatccggccaaacatcttcctgggagtcgcggagggctcagcccagtacaagaagtgg
tacttcgagctgattatcgaccaggtggaccccttcctaacagcagagcccacacatctg
cgggtgggctgggcctcttcttcaggctatgccccatacccaggaggtggagaaggatgg
ggaggcaatggtgttggtgacgacctgtactcctatggctttgatggacttcacctttgg
tcaggccggatacccagagctgtggcttccatcaaccagcacctcctgagatcggatgac
gtggtaagctgctgcctggacctcggggtgcccagcatctcattccgcatcaatgggcag
cccgtgcaggggatgtttgagaacttcaacacagacgggctcttcttccctgtgatgagc
ttttcagcaggtgtcaaagtacgtttcctgatgggtggacgtcatggagagtttaagttc
ctgcctccctctggctatgccccttgctatgaagccttacttccaaaagagaagatgaga
ttggagcctgtcaaagaatataaacgtgatgctgatggcattagagatctcttgggtacc
acccagttcctctcccaagcctctttcatcccatgccccgtagacaccagtcaggttatt
ttgccacctcacctagaaaagatccgagacagactagctgaaaacatccatgagctttgg
ggaatgaataaaatagaacttggctggactttcggcaagatacgagatgacaataaaaga
caacacccttgccttgtggagttttcaaagctcccagaaactgagaagaactataacctg
caaatgtcaactgaaaccttaaaaaccctcttggccctggggtgccacattgctcatgtt
aacccagctgctgaggaggatctcaagaaggtcaaactgcccaaaaactatatgatgtcc
aacggctataagccagcccctttggatttgtctgatgtgaagctgttacctcctcaagaa
attttagtggataagcttgcagaaaatgcacacaatgtttgggcaaaagacagaataaaa
caaggatggacctatggcatccaacaggatttgaagaacaaaagaaatccccgtctggtg
ccatatgcattactggatgagcgtaccaagaagtcaaacagggacagcctgcgggaagct
gtgcgcacttttgttggttacgggtataacattgagccatcagaccaagaactagctgac
tcggctgtggagaaggtcagcatagacaagatccgatttttccgggtagagcgatcttat
gcagtgagatctggaaagtggtattttgagtttgaagtggtgactggaggagacatgcga
gtcggctgggcgaggccaggctgtcgacctgatgtcgagctgggggccgatgaccaagcc
tttgtgtttgaaggcaacaggggccagcgttggcatcaaggaagtgggtattttgggcgt
acctggcagccaggggatgtggtcggatgtatgattaacctggatgatgcttcaatgatc
ttcacactgaatggggagctgctgatcaccaacaaaggctctgaacttgccttcgctgac
tacgagattgagaatggcttcgtgcccatctgctgtctgggtctatctcagatcggccgc
atgaatctcgggacagatgccagtaccttcaagttttataccatgtgcggtctccaagag
ggctttgagccttttgctgtcaacatgaacagagatgttgctatgtggttcagcaagcgc
ctcccgacgtttgtcaacgtgccaaaggatcatccacacatagaggtcatgaggattgat
ggcaccatggacagccctccgtgtctcaaggtgacgcataagacatttggcacacagaat
agcaatgccgacatgatctattgccgcttgagcatgcctgtcgagtgccactcctccttc
agccacagcccctgtctggacagtgaagctttccagaaaaggaaacagatgcaagaaata
ctctctcatacaacaacacagtgctactacgccatccgcatctttgctggacaggatcca
tcctgtgtctgggtcggatgggtgactccagactatcacttgtacagtgaaaagtttgac
ctgaataaaaactgcacagtgactgtcaccctaggggatgaaagaggccgggtccatgaa
agtgtgaaacgcagcaactgctacatggtctggggtggagacattgtagccagttcccag
agatcaaatcggagcaacgtggacctggagatcggctgtctcgtggatctggccatgggc
atgttgtccttctcagccaatggaaaggaactgggcacctgctaccaggtggagcctaat
accaaagtgtttccagcagtcttcctgcagcctacaagtacttctttgtttcagtttgaa
cttggaaagctgaagaacgcaatgcccctgtcagcggccatattcaggagtgaagagaag
aacccagtcccacagtgtccacctcggctggacgtccaaaccatccagcccgtgctctgg
agccgcatgcccaacagcttcctgaaggtggagaccgagcgtgtgagcgagcgccacggc
tgggtggtgcagtgcctggagcccctgcagatgatggcgctccacatccccgaggagaac
aggtgtgtggatatcctggagctctgtgagcaggaggacctgatgcggttccattaccac
acgctgaggctctacagcgcggtgtgcgccctgggaaacagccgcgtggcctacgccctg
tgcagccacgtggacctctcccagctcttctatgccattgacaacaagtacctccccggc
ctccttcgatctggtttctatgacctgctcatcagcatccacctggccagcgccaaggag
aggaagctgatgatgaagaacgagtacatcatccccattaccagcaccaccaggaatatc
cgcctcttcccggacgagtccaagaggcatggactgcctggggtgggcctgagaacatgt
ctcaagcccgggttcaggttctccaccccttgctttgttgtgactggtgaggatcaccaa
aagcagagccccgagattcccttggagagtctcaggacgaaggctctgagtatgctgaca
gaggcagtgcagtgcagcggggcccacatccgagaccctgtaggggggtctgtggagttc
cagtttgtgcctgtgctgaaactcattggaaccctgctggtcatgggcgtgtttgatgat
gatgatgttcggcagatcctcctcctgattgatccctctgtgtttggggagcatagtgcg
gggacagaggagggagcagaaaaggaggaagtgacccaggtggaggagaaggctgtggag
gctggggagaaggccggcaaggaggctcctgtcaaaggcttgttgcagactcgattaccc
gaatccgtcaagctgcagatgtgtgagctcctcagctatctctgcgactgtgagctgcag
caccgagtggaggccattgtggcatttggtgacatttatgtctccaagctgcaggcaaat
cagaagttccgctacaatgagctcatgcaggccctgaacatgtctgcggccctgactgcc
cggaagaccaaggagttccgctcacccccacaggagcagatcaacatgctgcttaacttt
caactgggagagaactgcccctgcccagaggagattcgggaggagctgtatgatttccat
gaggaccttctccttcactgtggggttcctttggaagaagaggaagaggaggaggaggac
acctcctggacaggaaaactctgtgccttggtttacaaaatcaaaggcccacccaagcca
gagaaggagcagccgacggaggaggaggagagatgccccacaacattgaaggaactcatc
tcacagacgatgatctgctgggcccaggaggaccagatccaggattcagagctggtccga
atgatgttcaacctcctccggaggcagtatgacagcattggggagctgctgcaggcgctg
cggaagacctacaccatcagccacacctctgtaagcgacaccatcaacctgctggctgcc
ctgggccaaatccgctccctcctcagtgtcaggatgggcaaggaagaggagttgctcatg
atcaatgggctgggagacataatgaacaacaaggtgttttaccagcatcccaacctcatg
agagtcctgggcatgcacgagacggtgatggaggtgatggtgaacgtgttgggtacagag
aaatctcagattgcatttccaaagatggttgctagctgctgccgtttcctttgctatttc
tgtcgaattagccggcaaaatcagaaggccatgtttgagcatctgagttatcttctggag
aatagcagtgttggcctagcctccccgtcgatgaggggatccaccccgctggatgtggca
gcttcctctgtgatggacaacaatgagttagcgctgagcttagaggaaccagacctcgag
aaggtggtgacctacttggcaggctgtggcctacagagctgccccatgcttctggccaaa
ggataccctgatgtcggctggaaccccattgaaggggaacgctacctgtccttcctgagg
tttgctgtcttcgtgaacagtgagagtgtggaagaaaacgccagcgttgtggtcaagctg
ctcatcagacgcccagagtgcttcggcccggccctgcggggtgaggggggaaacgggctc
ttggcagccatgcagggtgccattaagatctctgagaacccagcgctcgacctcccctct
caaggatacaaaagagaagtcagcacgggggacgatgaagaggaagaagaaatcgtgcat
atgggcaatgcaattatgtcattttattcggcccttatagatctactgggccgctgtgct
cctgaaatgcacctcatccagacaggaaagggggaagccatccgcatcaggtccatcctg
cgctccctggtccccacagaagacctggttgggatcatcagcatccccttgaaactgccc
tccctcaacaaagatgggtcggtcagtgagccagatatggcggccaatttctgccctgac
cacaaggcacctatggtgctgttcttggaccgcgtttatggcattaaggatcaaactttt
ctgctccacttgctggaggttggatttttacctgacctaagagcttctgcctctctagat
acagtttccctaagcaccacagaggctgcgcttgcactaaataggtatatatgttctgct
gtgctcccgctcctcacaagatgtgcccctctctttgccggaacagaacactgcacctct
ctgattgattccacactgcagacaatatacaggctatccaagggacgttccctcaccaaa
gcacaaagggacactatagaagaatgtttgcttgccatttgcaatcacttgaggccttcc
atgttacagcaactcctgcgacgcctcgtttttgatgtgccgcaactcaatgaatactgc
aaaatgcctctcaagcttctgacgaatcactatgaacagtgttggaagtattactgcctg
ccttcaggatgggggagctacgggctagctgtggaagaagagctgcacctaacggagaag
cttttctgggggatttttgactcgctctcccataagaaatatgacccagatcttttccga
atggccctgccttgtctcagtgctatagctggggccttgccaccagattatttagatacc
agaatcacagccacgttggagaaacagatctcagtggatgcggatggcaactttgaccca
aaacctattaacaccatgaatttttccttgcctgaaaaattggaatacatcgtcaccaag
tatgctgagcattcacatgataaatgggcctgtgacaagagtcagagtggatggaaatat
gggatttccctggatgaaaatgtgaagacccacccactgataaggcctttcaagacatta
acggagaaggagaaggaaatttatcgctggcctgcgcgagagtccctgaaaaccatgctg
gctgtgggctggactgtggagaggaccaaagagggagaagctttggttcaacagcgggaa
aatgagaagcttcgaagtgtgtcccaggccaaccagggcaacagctacagtcctgctccc
ctcgacctctcaaacgttgtgctctccagagagctccagggaatggtggaggtcgtggct
gagaactatcacaatatctgggccaagaagaagaagctggagctggagagcaaaggtggt
ggcagccaccctcttctggtaccatatgacaccttgactgccaaggaaaagttcaaggac
cgggagaaggcacaggacctgtttaagttcctccaagtgaatggcatcatagtttccagg
ggtatgaaggatatggagctggatgcctcctccatggagaagaggtttgcctataagttc
ttgaagaagatcctgaaatacgttgattctgctcaagaatttattgcccatttagaagcc
attgtcagcagtgggaaaactgaaaagtctccccgtgaccaggagatcaaattctttgcc
aaagttctcctcccgctggttgaccagtacttcaccagtcattgcctctacttcttgtca
tcccctctgaagccccttagcagcagcggatatgcctcccataaggagaaagaaatggtg
gccggcctgttctgcaaacttgccgctctcgttagacacagaatttccctctttggtagt
gattctactacaatggtgagctgtcttcacatcttagctcagacacttgacacaaggact
gtcatgaagtcaggctcagagctggtgaaggctgggttacgagcattctttgaaaatgct
gcagaagatttggagaagacttcagaaaacctgaaacttgggaagttcacccattcccga
acgcagattaaaggcgtttctcagaatattaactacactacagtggctctgctccccatc
ctgacgtccatctttgagcacgtcactcagcatcagtttggaatggatctactcttgggt
gatgtgcagatttcatgctaccacatactgtgcagcctctactcccttgggacgggaaag
aacatttatgttgaaaggcaacgccctgcccttggagaatgtctggcctcgctggcagct
gccataccagtggcattcctggagcccacccttaatcgctacaatccactctcggtcttc
aacaccaaaacccccagggagaggtctattctggggatgccagacacggtagaagacatg
tgtcctgacatcccccagctggaaggcctgatgaaggaaatcaacgacctggccgagtca
ggggcccggtacacagagatgccccatgtcatcgaggtgatcttacccatgctctgcaac
tacttgtcctactggtgggagcggggtcctgagaacctgccccccagcacagggccatgc
tgcaccaaggtcacctctgaacacctcagtctcatcctgggcaacattctgaaaatcatc
aacaacaacctgggcatcgatgaggcctcctggatgaagcgcattgcagtgtatgcacag
cccatcatcagcaaagccaggcccgacctgctgagaagccacttcatcccaactctggag
aagctgaagaaaaaggctgtcaagacggtgcaggaggaggagcagttgaaagccgatggc
aaaggggacacccaggaggcagaactcctcatcctggacgagttcgcggtcctctgcaga
gatctctatgccttctaccccatgctgatccgctacgtggacaacaacagatctaactgg
ctgaaaagtcctgatgctgattctgaccagctcttccgcatggtggcagaagtcttcatt
ctgtggtgtaaatctcataacttcaagagagaagagcaaaattttgtgattcagaatgaa
attaataatttggcatttttaactggagacagcaaaagcaagatgtcaaaagccatgcaa
gtaaagtctggaggacaagaccaggagcggaagaagacaaagcggcggggagacttgtat
tccatccagacctccctcatcgtggctgcactcaagaaaatgctgcccattggtttgaat
atgtgtactccaggcgaccaggagctgatctccctcgcaaaatcgcgatacagccatagg
gacacagatgaagaggtcagagaacatctgcggaacaacttgcacttgcaggaaaagtct
gatgacccagctgtaaaatggcaactgaacctctacaaggatgttctgaagagtgaagaa
cctttcaatccggaaaagacagtggagcgtgtgcagagaatttcagcagctgtcttccac
ctggaacaggtggaacagcctttgaggtccaagaaggccgtctggcacaaactgttatca
aagcaacggaaacgggcagtggtggcctgtttcaggatggcccctctctacaacctgccc
aggcaccgctctattaacctcttcctccatggctatcagagattttggatagaaacagag
gagtattcctttgaagagaaactagtacaggatttggctaaatctccaaaggtggaagag
gaggaggaggaagagacagaaaaacaacctgacccactacatcagatcattctctatttt
agccgcaacgctctcacggagaggagcaaattggaagacgaccctttgtacacctcctat
tccagcatgatggccaagagttgtcaaagtggtgaggatgaagaagaagatgaagacaag
gaaaaaacattcgaagagaaagagatggagaagcaaaaaaccctctatcagcaagctcgg
ctgcatgagcgtggtgctgcagagatggtccttcagatgataagcgctagcaaaggtgag
atgagccccatggtggttgagacgctgaagctggggatcgccattctgaacggaggcaat
gctggtgtgcaacagaaaatgctagattacctaaaggagaaaaaggatgctggattcttt
caaagcctttctggtcttatgcagtcttgcagtgtccttgatttgaatgcatttgagagg
cagaataaagctgaaggcctggggatggtgactgaagaaggaacactcattgttcgggaa
cgtggtgaaaaagtactccagaatgacgagttcacgcgtgatctctttagattcctacag
ttactttgtgagggacataacagtgactttcagaacttcctgcggactcagatgggcaac
accaccaccgtgaatgtcatcatcagcactgtggactaccttctgcgtctgcaggaatca
atcagtgatttctactggtattattcagggaaggacatcattgatgaatctggacagcac
aatttttccaaagctctggcagtcaccaagcagattttcaattctcttacagaatacatc
cagggcccttgcattggtaatcaacagagcctggctcacagcaggctgtgggacgcagtg
gttggcttcctccatgtctttgctaatatgcagatgaaactctctcaggattccagtcag
atcgagctgctgaaggaactcttggatctccttcaggacatggtggtgatgcttctgtcc
ctcctggaagggaatgtggtaaatggcaccattggcaagcagatggttgacacactggta
gaatcatctaccaatgtagaaatgatcttgaaattctttgacatgttcttgaaacttaaa
gacttaaccagctcagacaccttcaaagaatatgacccagatggtaaaggaattatctcc
aaaaaagaattccagaaggccatggaagggcaaaaacagtacacgcagtcagagattgac
tttctcctgtcgtgtgcagaagctgatgagaatgacatgtttaattacgttgattttgta
gaccggttccatgagccagccaaggacatagggtttaatgtggctgtgttattgacaaat
ctttctgaacacatgccaaacgattcccgcctgaagtgtctgttggacccagcagaaagt
gtgctaaattacttcgaaccctacctaggacgcatcgagatcatgggtggggccaagaag
attgagcgtgtttattttgagatcagtgaatccagtcgcactcagtgggagaagccccag
gtgaaggaatctaagcgacagttcatttttgatgttgtcaatgaaggtggggagcaggaa
aagatggagctgtttgtgaacttctgtgaggacaccatctttgaaatgcagttagcatct
cagatctctgaatccgattcagctgacaggccagaagaggaggaagaagatgaagattct
tcttacgtgttagaaattgcgggtgaagaggaagaagacgggtctcttgagccggcctct
gcatttgctatggcctgtgcctctgtgaagaggaatgtcaccgacttcctgaagagagca
accctgaagaacctcaggaagcagtacaggaacgtgaaaaagatgactgcgaaggagctg
gtgaaggtgctcttctcctttttctggatgctgttcgtggggctattccagttgctcttc
accatcctgggaggaatctttcagatcctctggagcacagtgtttggagggggcctggta
gaaggggcaaagaacatcagagtgaccaagatcctgggtgacatgcctgacccaacccaa
tttggtatccatgatgacactatggaggctgagagggcagaggtgatggagccaggtatc
accactgaactagtacacttcataaagggggagaagggagatacagatatcatgtcagac
ctctttggactccacccaaagaaagagggcagcttaaagcatgggcctgaagtgggtttg
ggtgacctctcagaaattattggcaaggatgaaccccctacattagagagtactgtacag
aagaagaggaaagctcaggcagcagaaatgaaagcagcaaatgaagcagaaggaaaagta
gaatccgagaaggcagacatggaagatggagagaaggaagacaaagacaaagaagaggag
caagctgagtacctgtggacagaagtgacaaaaaagaagaagcggcggtgtggtcagaag
gttgagaagccggaagctttcacagccaatttctttaaagggctggaaatctatcagacc
aagttactgcattacctggccaggaatttctacaacctgaggttccttgctctgtttgta
gccttcgctatcaacttcatcctgcttttttataaggtcactgaagaacctttagaagaa
gagacagaggatgttgcaaacctatggaattcctttaatgacgaggaagaggaagaagcg
atggtattctttgtccttcaggagagcaccgggtatatggcaccaaccctgcgtgccctg
gccatcatccataccatcatctctctagtctgtgtggtgggctactactgcctgaaggtg
cctttggtggttttcaaaagggaaaaagaaatcgccaggaagctggagtttgatggccta
tatatcaccgaacagccatctgaagatgacatcaaggggcagtgggaccgcttggtgatc
aacacaccatcttttcctaataactactgggacaagtttgtaaagagaaaggtgatcaac
aagtatggagatctctacggagcagaacgcattgctgaacttctgggtttggacaaaaat
gctcttgactttagcccagtagaagagaccaaagcagaagcggcttctctggtgtcatgg
ctaagttccatagacatgaagtaccatatctggaagcttggagttgtttttactgacaac
tcctttctctaccttgcctggtatacaaccatgtcagtcctgggccactacaataacttc
ttctttgctgctcacctattggacatcgcaatgggcttcaagacactgaggaccattctg
tcatctgtaactcacaatggcaaacagttggttctgactgtcggtctcctggccgtggtg
gtttatctctatactgtggtggctttcaacttcttccgcaagttctacaacaaaagcgaa
gacgatgacgagcccgatatgaagtgcgacgacatgatgacgtgttaccttttccacatg
tacgtgggagtgagagcaggaggtggcattggtgatgaaattgaagaccctgctggtgat
ccttatgaaatgtatcgcattgtctttgacattacctttttcttcttcgtcattgtcatc
ttgctggccatcattcaaggtcttattattgatgctttcggagagctaagagaccagcag
gaacaagtacgagaagatatggagactaaatgtttcatctgtgggattggcaatgactac
tttgacacaacccctcatggttttgaaacacatacattacaagagcacaacttagccaac
tacttgttctttctgatgtatttgattaataaagatgaaacagagcacacgggtcaggaa
tcttatgtctggaagatgtaccaagaaaggtgttgggatttcttcccagccggtgactgc
tttcgtaaacaatatgaagatcagcttggataa

DBGET integrated database retrieval system