KEGG   Homo sapiens (human): 6302Help
Entry
6302              CDS       T01001                                 

Gene name
TSPAN31, SAS
Definition
(RefSeq) tetraspanin 31
  KO
K17356  tetraspanin-13/31
Organism
hsa  Homo sapiens (human)
Disease
H00036  Osteosarcoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    6302 (TSPAN31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin Ac76 PHO4
Motif
Other DBs
NCBI-GeneID: 6302
NCBI-ProteinID: NP_005972
OMIM: 181035
HGNC: 10539
Ensembl: ENSG00000135452
Vega: OTTHUMG00000170381
Pharos: Q12999(Tdark)
UniProt: Q12999
LinkDB All DBs
Position
12q14.1
AA seq 210 aa AA seqDB search
MVCGGFACSKNALCALNVVYMLVSLLLIGVAAWGKGLGLVSSIHIIGGVIAVGVFLLLIA
VAGLVGAVNHHQVLLFFYMIILGLVFIFQFVISCSCLAINRSKQTDVINASWWVMSNKTR
DELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGL
FFSFTEILGVWLAMRFRNQKDPRANPSAFL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggtttgtggcggctttgcctgctccaagaatgcgctttgcgctctcaacgtggtctac
atgctggtgagcttgttgctcattggagtggctgcttggggcaagggcctgggtctggtg
tccagcatccacatcatcggcggagtcattgctgtgggagtcttccttctccttattgca
gtggctggactggtgggtgctgtcaaccaccaccaagtcctgctgttcttttacatgatc
atccttggtttggtcttcatcttccaatttgtaatctcttgctcatgtctggctattaac
cgaagcaaacagacagatgtcatcaatgcttcttggtgggtcatgagcaacaagactcgg
gatgaactggaaagaagttttgattgttgtggcttattcaacctcacaaccctgtatcaa
caagattatgatttctgcactgcaatctgcaagagccagagccccacatgccagatgtgt
ggagaaaagtttcttaagcattcagacgaagccctgaaaatcctagggggtgttggactc
ttctttagctttacagagatccttggtgtttggctagcaatgagatttcggaatcagaag
gatcctagagccaaccccagtgcctttctatga

DBGET integrated database retrieval system