KEGG   Homo sapiens (human): 6319
Entry
6319              CDS       T01001                                 

Gene name
SCD, FADS5, MSTP008, SCD1, SCDOS, hSCD1
Definition
(RefSeq) stearoyl-CoA desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01040  Biosynthesis of unsaturated fatty acids
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    6319 (SCD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    6319 (SCD)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    6319 (SCD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    6319 (SCD)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     6319 (SCD)
Lipid biosynthesis proteins [BR:hsa01004]
 Desaturase
  First
   6319 (SCD)
SSDB
Other DBs
NCBI-GeneID: 6319
NCBI-ProteinID: NP_005054
OMIM: 604031
HGNC: 10571
Ensembl: ENSG00000099194
Vega: OTTHUMG00000018906
Pharos: O00767(Tchem)
UniProt: O00767
LinkDB
Structure
PDB: 
4ZYO

Position
10q24.31
AA seq 359 aa
MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYK
DKEGPSPKVEYVWRNIILMSLLHLGALYGITLIPTCKFYTWLWGVFYYFVSALGITAGAH
RLWSHRSYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFS
HVGWLLVRKHPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWGE
TFQNSVFVATFLRYAVVLNATWLVNSAAHLFGYRPYDKNISPRENILVSLGAVGEGFHNY
HHSFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAILARIKRTGDGNYKSG
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgccggcccacttgctgcaggacgatatctctagctcctataccaccaccaccaccatt
acagcgcctccctccagggtcctgcagaatggaggagataagttggagacgatgcccctc
tacttggaagacgacattcgccctgatataaaagatgatatatatgaccccacctacaag
gataaggaaggcccaagccccaaggttgaatatgtctggagaaacatcatccttatgtct
ctgctacacttgggagccctgtatgggatcactttgattcctacctgcaagttctacacc
tggctttggggggtattctactattttgtcagtgccctgggcataacagcaggagctcat
cgtctgtggagccaccgctcttacaaagctcggctgcccctacggctctttctgatcatt
gccaacacaatggcattccagaatgatgtctatgaatgggctcgtgaccaccgtgcccac
cacaagttttcagaaacacatgctgatcctcataattcccgacgtggctttttcttctct
cacgtgggttggctgcttgtgcgcaaacacccagctgtcaaagagaaggggagtacgcta
gacttgtctgacctagaagctgagaaactggtgatgttccagaggaggtactacaaacct
ggcttgctgatgatgtgcttcatcctgcccacgcttgtgccctggtatttctggggtgaa
acttttcaaaacagtgtgttcgttgccactttcttgcgatatgctgtggtgcttaatgcc
acctggctggtgaacagtgctgcccacctcttcggatatcgtccttatgacaagaacatt
agcccccgggagaatatcctggtttcacttggagctgtgggtgagggcttccacaactac
caccactcctttccctatgactactctgccagtgagtaccgctggcacatcaacttcacc
acattcttcattgattgcatggccgccctcggtctggcctatgaccggaagaaagtctcc
aaggccgccatcttggccaggattaaaagaaccggagatggaaactacaagagtggctga

KEGG   Homo sapiens (human): 79966
Entry
79966             CDS       T01001                                 

Gene name
SCD5, ACOD4, DFNA79, FADS4, HSCD5, SCD2, SCD4
Definition
(RefSeq) stearoyl-CoA desaturase 5
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01040  Biosynthesis of unsaturated fatty acids
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    79966 (SCD5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    79966 (SCD5)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    79966 (SCD5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    79966 (SCD5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     79966 (SCD5)
Lipid biosynthesis proteins [BR:hsa01004]
 Desaturase
  First
   79966 (SCD5)
SSDB
Motif
Pfam: FA_desaturase
Other DBs
NCBI-GeneID: 79966
NCBI-ProteinID: NP_001032671
OMIM: 608370
HGNC: 21088
Ensembl: ENSG00000145284
Vega: OTTHUMG00000130293
Pharos: Q86SK9(Tchem)
UniProt: Q86SK9 Q86UC8
LinkDB
Position
4q21.22
AA seq 330 aa
MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGA
VYSLVLIPKAKPLTLLWAYFCFLLAALGVTAGAHRLWSHRSYRAKLPLRIFLAVANSMAF
QNDIFEWSRDHRAHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLL
ADPVVRIQRKYYKISVVLMCFVVPTLVPWYIWGESLWNSYFLASILRYTISLNISWLVNS
AAHMYGNRPYDKHISPRQNPLVALGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFIDF
MCWLGLATDRKRATKPMIEARKARTGDSSA
NT seq 993 nt   +upstreamnt  +downstreamnt
atgccaggcccggccaccgacgcggggaagatccctttctgcgacgccaaggaagaaatc
cgtgccgggctcgaaagctctgagggcggcggcggcccggagaggccaggcgcgcgcggg
cagcggcagaacatcgtctggaggaatgtcgtcctgatgagcttgctccacttgggggcc
gtgtactccctggtgctcatccccaaagccaagccactcactctgctctgggcctacttc
tgcttcctcctggccgctctgggtgtgacagctggtgcccatcgcttgtggagccacagg
tcctaccgggccaagctgcctctgaggatatttctggctgtcgccaactccatggctttc
cagaatgacatcttcgagtggtccagggaccaccgagcccaccacaagtactcagagacg
gatgctgacccccacaatgcccgccggggcttcttcttctcccatattgggtggctgttt
gttcgcaagcatcgagatgttattgagaaggggagaaagcttgacgtcactgacctgctt
gctgatcctgtggtccggatccagagaaagtactataagatctccgtggtgctcatgtgc
tttgtggtccccacgctggtgccctggtacatctggggagagagtctgtggaattcctac
ttcttggcctctattctccgctataccatctcactcaacatcagctggctggtcaacagc
gccgcccacatgtatggaaaccggccctatgacaagcacatcagccctcggcagaaccca
ctcgtcgctctgggtgccattggtgaaggcttccataattaccatcacacctttcccttt
gactactctgcgagtgaatttggcttaaattttaacccaaccacctggttcattgatttc
atgtgctggctggggctggccactgaccgcaaacgggcaaccaagccgatgatcgaggcc
cggaaggccaggactggagacagcagtgcttga

DBGET integrated database retrieval system