KEGG   Homo sapiens (human): 6337Help
Entry
6337              CDS       T01001                                 

Gene name
SCNN1A, BESC2, ENaCa, ENaCalpha, SCNEA, SCNN1
Definition
(RefSeq) sodium channel epithelial 1 alpha subunit
  KO
K04824  amiloride-sensitive sodium channel subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
hsa04960  Aldosterone-regulated sodium reabsorption
Disease
H00243  Hyperkalemic distal renal tubular acidosis (RTA type 4)
H00892  Bronchiectasis with or without elevated sweat chloride
Drug target
Amiloride (DG00275): D00649 D07447
Triamterene: D00386
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    6337 (SCNN1A)
  Sensory system
   04742 Taste transduction
    6337 (SCNN1A)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Epithelial sodium channel (ENaC)
   6337 (SCNN1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ASC
Motif
Other DBs
NCBI-GeneID: 6337
NCBI-ProteinID: NP_001029
OMIM: 600228
HGNC: 10599
Ensembl: ENSG00000111319
Vega: OTTHUMG00000168268
Pharos: P37088(Tclin)
UniProt: P37088
LinkDB All DBs
Position
12p13.31
AA seq 669 aa AA seqDB search
MEGNKLEEQDSSPPQSTPGLMKGNKREEQGLGPEPAAPQQPTAEEEALIEFHRSYRELFE
FFCNNTTIHGAIRLVCSQHNRMKTAFWAVLWLCTFGMMYWQFGLLFGEYFSYPVSLNINL
NSDKLVFPAVTICTLNPYRYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDL
RGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIGFQLCNQNKSDCFYQT
YSSGVDAVREWYRFHYINILSRLPETLPSLEEDTLGNFIFACRFNQVSCNQANYSHFHHP
MYGNCYTFNDKNNSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPA
FMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSC
FQESMIKECGCAYIFYPRPQNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCS
VTSYQLSAGYSRWPSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESP
SVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVIMFLMLLRRFRSRYWSPGRGGR
GAQEVASTLASSPPSHFCPHPMSLSLSQPGPAPSPALTAPPPAYATLGPRPSPGGSAGAS
SSTCPLGGP
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggaggggaacaagctggaggagcaggactctagccctccacagtccactccagggctc
atgaaggggaacaagcgtgaggagcaggggctgggccccgaacctgcggcgccccagcag
cccacggcggaggaggaggccctgatcgagttccaccgctcctaccgagagctcttcgag
ttcttctgcaacaacaccaccatccacggcgccatccgcctggtgtgctcccagcacaac
cgcatgaagacggccttctgggcagtgctgtggctctgcacctttggcatgatgtactgg
caattcggcctgcttttcggagagtacttcagctaccccgtcagcctcaacatcaacctc
aactcggacaagctcgtcttccccgcagtgaccatctgcaccctcaatccctacaggtac
ccggaaattaaagaggagctggaggagctggaccgcatcacagagcagacgctctttgac
ctgtacaaatacagctccttcaccactctcgtggccggctcccgcagccgtcgcgacctg
cgggggactctgccgcaccccttgcagcgcctgagggtcccgcccccgcctcacggggcc
cgtcgagcccgtagcgtggcctccagcttgcgggacaacaacccccaggtggactggaag
gactggaagatcggcttccagctgtgcaaccagaacaaatcggactgcttctaccagaca
tactcatcaggggtggatgcggtgagggagtggtaccgcttccactacatcaacatcctg
tcgaggctgccagagactctgccatccctggaggaggacacgctgggcaacttcatcttc
gcctgccgcttcaaccaggtctcctgcaaccaggcgaattactctcacttccaccacccg
atgtatggaaactgctatactttcaatgacaagaacaactccaacctctggatgtcttcc
atgcctggaatcaacaacggtctgtccctgatgctgcgcgcagagcagaatgacttcatt
cccctgctgtccacagtgactggggcccgggtaatggtgcacgggcaggatgaacctgcc
tttatggatgatggtggctttaacttgcggcctggcgtggagacctccatcagcatgagg
aaggaaaccctggacagacttgggggcgattatggcgactgcaccaagaatggcagtgat
gttcctgttgagaacctttacccttcaaagtacacacagcaggtgtgtattcactcctgc
ttccaggagagcatgatcaaggagtgtggctgtgcctacatcttctatccgcggccccag
aacgtggagtactgtgactacagaaagcacagttcctgggggtactgctactataagctc
caggttgacttctcctcagaccacctgggctgtttcaccaagtgccggaagccatgcagc
gtgaccagctaccagctctctgctggttactcacgatggccctcggtgacatcccaggaa
tgggtcttccagatgctatcgcgacagaacaattacaccgtcaacaacaagagaaatgga
gtggccaaagtcaacatcttcttcaaggagctgaactacaaaaccaattctgagtctccc
tctgtcacgatggtcaccctcctgtccaacctgggcagccagtggagcctgtggttcggc
tcctcggtgttgtctgtggtggagatggctgagctcgtctttgacctgctggtcatcatg
ttcctcatgctgctccgaaggttccgaagccgatactggtctccaggccgagggggcagg
ggtgctcaggaggtagcctccaccctggcatcctcccctccttcccacttctgcccccac
cccatgtctctgtccttgtcccagccaggccctgctccctctccagccttgacagcccct
ccccctgcctatgccaccctgggcccccgcccatctccagggggctctgcaggggccagt
tcctccacctgtcctctgggggggccctga

DBGET integrated database retrieval system