KEGG   Homo sapiens (human): 6366Help
Entry
6366              CDS       T01001                                 

Gene name
CCL21, 6Ckine, CKb9, ECL, SCYA21, SLC, TCA4
Definition
(RefSeq) C-C motif chemokine ligand 21
  KO
K16062  C-C motif chemokine 21
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6366 (CCL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6366 (CCL21)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6366 (CCL21)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6366 (CCL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6366 (CCL21)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6366 (CCL21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6366
NCBI-ProteinID: NP_002980
OMIM: 602737
HGNC: 10620
Ensembl: ENSG00000137077
Vega: OTTHUMG00000019838
Pharos: O00585(Tbio)
UniProt: O00585
LinkDB All DBs
Structure
PDB: 

Position
9p13.3
AA seq 134 aa AA seqDB search
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIP
AILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSK
GCKRTERSQTPKGP
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtcactggctctgagcctccttatcctggttctggcctttggcatccccagg
acccaaggcagtgatggaggggctcaggactgttgcctcaagtacagccaaaggaagatt
cccgccaaggttgtccgcagctaccggaagcaggaaccaagcttaggctgctccatccca
gctatcctgttcttgccccgcaagcgctctcaggcagagctatgtgcagacccaaaggag
ctctgggtgcagcagctgatgcagcatctggacaagacaccatccccacagaaaccagcc
cagggctgcaggaaggacaggggggcctccaagactggcaagaaaggaaagggctccaaa
ggctgcaagaggactgagcggtcacagacccctaaagggccatag

DBGET integrated database retrieval system