KEGG   Homo sapiens (human): 6372
Entry
6372              CDS       T01001                                 

Gene name
CXCL6, CKA-3, GCP-2, GCP2, SCYB6
Definition
(RefSeq) C-X-C motif chemokine ligand 6
  KO
K05506  C-X-C motif chemokine 5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05133  Pertussis
hsa05323  Rheumatoid arthritis
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01233  CXCL1/5/6/8 to CXCR1 signaling
N01235  CXCL6 to KSHV vGPCR signaling
N01238  CXCL1/2/3/5/6/7/8 to CXCR2 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6372 (CXCL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6372 (CXCL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6372 (CXCL6)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6372 (CXCL6)
   04062 Chemokine signaling pathway
    6372 (CXCL6)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    6372 (CXCL6)
  09171 Infectious disease: bacterial
   05133 Pertussis
    6372 (CXCL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6372 (CXCL6)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6372 (CXCL6)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6372
NCBI-ProteinID: NP_002984
OMIM: 138965
HGNC: 10643
Ensembl: ENSG00000124875
Vega: OTTHUMG00000130010
Pharos: P80162(Tbio)
UniProt: P80162
LinkDB
Position
4q13.3
AA seq 114 aa
MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNP
KTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
NT seq 345 nt   +upstreamnt  +downstreamnt
atgagcctcccgtccagccgcgcggcccgtgtcccgggtccttcgggctccttgtgcgcg
ctgctcgcgctgctgctcctgctgacgccgccggggcccctcgccagcgctggtcctgtc
tctgctgtgctgacagagctgcgttgcacttgtttacgcgttacgctgagagtaaacccc
aaaacgattggtaaactgcaggtgttccccgcaggcccgcagtgctccaaggtggaagtg
gtagcctccctgaagaacgggaagcaagtttgtctggacccggaagccccttttctaaag
aaagtcatccagaaaattttggacagtggaaacaagaaaaactga

KEGG   Homo sapiens (human): 6374
Entry
6374              CDS       T01001                                 

Gene name
CXCL5, ENA-78, SCYB5
Definition
(RefSeq) C-X-C motif chemokine ligand 5
  KO
K05506  C-X-C motif chemokine 5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05133  Pertussis
hsa05323  Rheumatoid arthritis
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01233  CXCL1/5/6/8 to CXCR1 signaling
N01234  CXCL1/5/8 to KSHV vGPCR signaling
N01238  CXCL1/2/3/5/6/7/8 to CXCR2 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6374 (CXCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6374 (CXCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6374 (CXCL5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6374 (CXCL5)
   04062 Chemokine signaling pathway
    6374 (CXCL5)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    6374 (CXCL5)
  09171 Infectious disease: bacterial
   05133 Pertussis
    6374 (CXCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6374 (CXCL5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6374 (CXCL5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6374
NCBI-ProteinID: NP_002985
OMIM: 600324
HGNC: 10642
Ensembl: ENSG00000163735
Vega: OTTHUMG00000160871
Pharos: P42830(Tbio)
UniProt: P42830 Q6I9S7
LinkDB
Structure
PDB: 
2MGS

Position
4q13.3
AA seq 114 aa
MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHP
KMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
NT seq 345 nt   +upstreamnt  +downstreamnt
atgagcctcctgtccagccgcgcggcccgtgtccccggtccttcgagctccttgtgcgcg
ctgttggtgctgctgctgctgctgacgcagccagggcccatcgccagcgctggtcctgcc
gctgctgtgttgagagagctgcgttgcgtttgtttacagaccacgcaaggagttcatccc
aaaatgatcagtaatctgcaagtgttcgccataggcccacagtgctccaaggtggaagtg
gtagcctccctgaagaacgggaaggaaatttgtcttgatccagaagccccttttctaaag
aaagtcatccagaaaattttggacggtggaaacaaggaaaactga

DBGET integrated database retrieval system