KEGG   Homo sapiens (human): 6373Help
Entry
6373              CDS       T01001                                 

Gene name
CXCL11, H174, I-TAC, IP-9, IP9, SCYB11, SCYB9B, b-R1
Definition
(RefSeq) C-X-C motif chemokine ligand 11
  KO
K12672  C-X-C motif chemokine 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
Disease
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6373 (CXCL11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6373 (CXCL11)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6373 (CXCL11)
   04062 Chemokine signaling pathway
    6373 (CXCL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6373 (CXCL11)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6373 (CXCL11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6373
NCBI-ProteinID: NP_005400
OMIM: 604852
HGNC: 10638
Ensembl: ENSG00000169248
Vega: OTTHUMG00000130101
Pharos: O14625(Tbio)
UniProt: O14625
LinkDB All DBs
Position
4q21.1
AA seq 94 aa AA seqDB search
MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKI
EVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgaagggcatggctatagccttggctgtgatattgtgtgctacagttgttcaa
ggcttccccatgttcaaaagaggacgctgtctttgcataggccctggggtaaaagcagtg
aaagtggcagatattgagaaagcctccataatgtacccaagtaacaactgtgacaaaata
gaagtgattattaccctgaaagaaaataaaggacaacgatgcctaaatcccaaatcgaag
caagcaaggcttataatcaaaaaagttgaaagaaagaatttttaa

DBGET integrated database retrieval system