KEGG   Homo sapiens (human): 6382Help
Entry
6382              CDS       T01001                                 

Gene name
SDC1, CD138, SDC, SYND1, syndecan
Definition
(RefSeq) syndecan 1
  KO
K06257  syndecan 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa05144  Malaria
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    6382 (SDC1)
   04514 Cell adhesion molecules (CAMs)
    6382 (SDC1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    6382 (SDC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    6382 (SDC1)
  09174 Infectious disease: parasitic
   05144 Malaria
    6382 (SDC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6382 (SDC1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    6382 (SDC1)
   00535 Proteoglycans [BR:hsa00535]
    6382 (SDC1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    6382 (SDC1)
CD molecules [BR:hsa04090]
 Proteins
  6382 (SDC1)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   6382 (SDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syndecan Romo1 DUF3592 Glycophorin_A
Motif
Other DBs
NCBI-GeneID: 6382
NCBI-ProteinID: NP_001006947
OMIM: 186355
HGNC: 10658
Ensembl: ENSG00000115884
Vega: OTTHUMG00000090751
Pharos: P18827(Tbio)
UniProt: P18827
LinkDB All DBs
Position
2p24.1
AA seq 310 aa AA seqDB search
MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQ
TPSTWKDTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQE
ATPRPRETTQLPTTHQASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHT
EDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGAT
GASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQ
KPTKQEEFYA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgcgcggcgctctggctctggctgtgcgcgctggcgctgagcctgcagccggcc
ctgccgcaaattgtggctactaatttgccccctgaagatcaagatggctctggggatgac
tctgacaacttctccggctcaggtgcaggtgctttgcaagatatcaccttgtcacagcag
accccctccacttggaaggacacgcagctcctgacggctattcccacgtctccagaaccc
accggcctggaggctacagctgcctccacctccaccctgccggctggagaggggcccaag
gagggagaggctgtagtcctgccagaagtggagcctggcctcaccgcccgggagcaggag
gccaccccccgacccagggagaccacacagctcccgaccactcatcaggcctcaacgacc
acagccaccacggcccaggagcccgccacctcccacccccacagggacatgcagcctggc
caccatgagacctcaacccctgcaggacccagccaagctgaccttcacactccccacaca
gaggatggaggtccttctgccaccgagagggctgctgaggatggagcctccagtcagctc
ccagcagcagagggctctggggagcaggacttcacctttgaaacctcgggggagaatacg
gctgtagtggccgtggagcctgaccgccggaaccagtccccagtggatcagggggccacg
ggggcctcacagggcctcctggacaggaaagaggtgctgggaggggtcattgccggaggc
ctcgtggggctcatctttgctgtgtgcctggtgggtttcatgctgtaccgcatgaagaag
aaggacgaaggcagctactccttggaggagccgaaacaagccaacggcggggcctaccag
aagcccaccaaacaggaggaattctatgcctga

DBGET integrated database retrieval system