KEGG   Homo sapiens (human): 63970
Entry
63970             CDS       T01001                                 

Gene name
TP53AIP1, P53AIP1
Definition
(RefSeq) tumor protein p53 regulated apoptosis inducing protein 1
  KO
K13773  p53-regulated apoptosis-inducing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    63970 (TP53AIP1)
   04115 p53 signaling pathway
    63970 (TP53AIP1)
SSDB
Motif
Pfam: TPIP1
Other DBs
NCBI-GeneID: 63970
NCBI-ProteinID: NP_071395
OMIM: 605426
HGNC: 29984
Ensembl: ENSG00000120471
Vega: OTTHUMG00000165797
Pharos: Q9HCN2(Tbio)
UniProt: Q9HCN2
LinkDB
Position
11q24.3
AA seq 124 aa
MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHG
GCRGIEALSVSSGSWSSATVWILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAP
LRLQ
NT seq 375 nt   +upstreamnt  +downstreamnt
atgggatcttcctctgaggcgagcttcagatctgctcaagcttcctgcagtggggccagg
aggcagggcctgggcaggggagaccagaacctctcggtgatgcctccgaatggcagggct
cagacacacacacctggctgggtttcagatcccttagttttgggtgcccaagttcacgga
gggtgccggggaatagaagctctgtcagtctcgtctggatcttggtcctcagcaactgtc
tggatcctgacaggccttggtctaggtctctccaggcctttccttcctggagccacagtg
cttagagacaggccactggggtcagcatttgagctcagctatgatcagaaaaaagcaccg
ttgaggttgcagtga

DBGET integrated database retrieval system