KEGG   Homo sapiens (human): 64101Help
Entry
64101             CDS       T01001                                 

Gene name
LRRC4, NAG14, NGL-2
Definition
(RefSeq) leucine rich repeat containing 4
  KO
K16351  netrin-G2 ligand
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    64101 (LRRC4)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    64101 (LRRC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 I-set Ig_3 LRR_9 LRR_1 V-set ig Ig_6 LRRNT Ig_2 DAG1 Insulin_TMD
Motif
Other DBs
NCBI-GeneID: 64101
NCBI-ProteinID: NP_071426
OMIM: 610486
HGNC: 15586
Ensembl: ENSG00000128594
Vega: OTTHUMG00000157563
Pharos: Q9HBW1(Tbio)
UniProt: Q9HBW1
LinkDB All DBs
Structure
PDB: 

Position
7q32.1
AA seq 653 aa AA seqDB search
MKLLWQVTVHHHTWNAILLPFVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVV
CTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFN
GLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGE
LKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHG
LSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHN
PWNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAPR
DLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTG
VYTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTS
TGYQPAYTTSTTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTKIIIGCFVAVTLLA
AAMLIVFYKLRKRHQQRSTVTAARTVEIIQVDEDIPAATSAAATAAPSGVSGEGAVVLPT
IHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcttgtggcaggtaactgtgcaccaccacacctggaatgccatcctgctcccg
ttcgtctacctcacggcgcaagtgtggattctgtgtgcagccatcgctgctgccgcctca
gccgggccccagaactgcccctccgtctgctcgtgcagtaaccagttcagcaaggtggtg
tgcacgcgccggggcctctccgaggtcccgcagggtattccctcgaacacccggtacctc
aacctcatggagaacaacatccagatgatccaggccgacaccttccgccacctccaccac
ctggaggtcctgcagttgggcaggaactccatccggcagattgaggtgggggccttcaac
ggcctggccagcctcaacaccctggagctgttcgacaactggctgacagtcatccctagc
ggggcctttgaatacctgtccaagctgcgggagctctggcttcgcaacaaccccatcgaa
agcatcccctcttacgccttcaaccgggtgccctccctcatgcgcctggacttgggggag
ctcaagaagctggagtatatctctgagggagcttttgaggggctgttcaacctcaagtat
ctgaacttgggcatgtgcaacattaaagacatgcccaatctcacccccctggtggggctg
gaggagctggagatgtcagggaaccacttccctgagatcaggcctggctccttccatggc
ctgagctccctcaagaagctctgggtcatgaactcacaggtcagcctgattgagcggaat
gcttttgacgggctggcttcacttgtggaactcaacttggcccacaataacctctcttct
ttgccccatgacctctttaccccgctgaggtacctggtggagttgcatctacaccacaac
ccttggaactgtgattgtgacattctgtggctagcctggtggcttcgagagtatataccc
accaattccacctgctgtggccgctgtcatgctcccatgcacatgcgaggccgctacctc
gtggaggtggaccaggcctccttccagtgctctgcccccttcatcatggacgcacctcga
gacctcaacatttctgagggtcggatggcagaacttaagtgtcggactccccctatgtcc
tccgtgaagtggttgctgcccaatgggacagtgctcagccacgcctcccgccacccaagg
atctctgtcctcaacgacggcaccttgaacttttcccacgtgctgctttcagacactggg
gtgtacacatgcatggtgaccaatgttgcaggcaactccaacgcctcggcctacctcaat
gtgagcacggctgagcttaacacctccaactacagcttcttcaccacagtaacagtggag
accacggagatctcgcctgaggacacaacgcgaaagtacaagcctgttcctaccacgtcc
actggttaccagccggcatataccacctctaccacggtgctcattcagactacccgtgtg
cccaagcaggtggcagtacccgcgacagacaccactgacaagatgcagaccagcctggat
gaagtcatgaagaccaccaagatcatcattggctgctttgtggcagtgactctgctagct
gccgccatgttgattgtcttctataaacttcgtaagcggcaccagcagcggagtacagtc
acagccgcccggactgttgagataatccaggtggacgaagacatcccagcagcaacatcc
gcagcagcaacagcagctccgtccggtgtatcaggtgagggggcagtagtgctgcccaca
attcatgaccatattaactacaacacctacaaaccagcacatggggcccactggacagaa
aacagcctggggaactctctgcaccccacagtcaccactatctctgaaccttatataatt
cagacccataccaaggacaaggtacaggaaactcaaatatga

DBGET integrated database retrieval system