KEGG   Homo sapiens (human): 64109Help
Entry
64109             CDS       T01001                                 

Gene name
CRLF2, CRL2, CRLF2Y, TSLPR
Definition
(RefSeq) cytokine receptor like factor 2
  KO
K05078  thymic stromal-derived lymphopoietin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
Disease
H00001  B-cell acute lymphoblastic leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    64109 (CRLF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    64109 (CRLF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    64109 (CRLF2)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   64109 (CRLF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Tissue_fac C1-set Interfer-bind IL6Ra-bind Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 64109
NCBI-ProteinID: NP_071431
OMIM: 300357 400023
HGNC: 14281
Ensembl: ENSG00000205755
Vega: OTTHUMG00000067432
Pharos: Q9HC73(Tbio)
UniProt: Q9HC73 D0E2W4
LinkDB All DBs
Structure
PDB: 

Position
Xp22.33 and Yp11.2
AA seq 371 aa AA seqDB search
MGRLVLLWGAAVFLLGGWMALGQGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHY
RFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPS
SPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKC
YSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKFILISSLAI
LLMVSLLLLSLWKLWRVKKFLIPSVPDPKSIFPGLFEIHQGNFQEWITDTQNVAHLHKMA
GAEQESGPEEPLVVQLAKTEAESPRMLDPQTEEKEASGGSLQLPHQPLQGGDVVTIGGFT
FVMNDRSYVAL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggggcggctggttctgctgtggggagctgccgtctttctgctgggaggctggatggct
ttggggcaaggaggagcagcagaaggagtacagattcagatcatctacttcaatttagaa
accgtgcaggtgacatggaatgccagcaaatactccaggaccaacctgactttccactac
agattcaacggtgatgaggcctatgaccagtgcaccaactaccttctccaggaaggtcac
acttcggggtgcctcctagacgcagagcagcgagacgacattctctatttctccatcagg
aatgggacgcaccccgttttcaccgcaagtcgctggatggtttattacctgaaacccagt
tccccgaagcacgtgagattttcgtggcatcaggatgcagtgacggtgacgtgttctgac
ctgtcctacggggatctcctctatgaggttcagtaccggagccccttcgacaccgagtgg
cagtccaaacaggaaaatacctgcaacgtcaccatagaaggcttggatgccgagaagtgt
tactctttctgggtcagggtgaaggctatggaggatgtatatgggccagacacataccca
agcgactggtcagaggtgacatgctggcagagaggcgagattcgggatgcctgtgcagag
acaccaacgcctcccaaaccaaagctgtccaaatttattttaatttccagcctggccatc
cttctgatggtgtctctcctccttctgtctttatggaaattatggagagtgaagaagttt
ctcattcccagcgtgccagacccgaaatccatcttccccgggctctttgagatacaccaa
gggaacttccaggagtggatcacagacacccagaacgtggcccacctccacaagatggca
ggtgcagagcaagaaagtggccccgaggagcccctggtagtccagttggccaagactgaa
gccgagtctcccaggatgctggacccacagaccgaggagaaagaggcctctgggggatcc
ctccagcttccccaccagcccctccaaggcggtgatgtggtcacaatcgggggcttcacc
tttgtgatgaatgaccgctcctacgtggcgttgtga

DBGET integrated database retrieval system