KEGG   Homo sapiens (human): 64127Help
Entry
64127             CDS       T01001                                 

Gene name
NOD2, ACUG, BLAU, BLAUS, CARD15, CD, CLR16.3, IBD1, NLRC2, NOD2B, PSORAS1, YAOS
Definition
(RefSeq) nucleotide binding oligomerization domain containing 2
  KO
K10165  nucleotide-binding oligomerization domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05131  Shigellosis
hsa05152  Tuberculosis
hsa05321  Inflammatory bowel disease (IBD)
Disease
H00285  Blau syndrome
H00286  Crohn's disease
H01227  Inflammatory bowel disease (IBD)
H01309  Sarcoidosis, early-onset
H01358  Atopic dermatitis
Drug target
Mifamurtide: D06619
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    64127 (NOD2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    64127 (NOD2)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    64127 (NOD2)
  Infectious diseases
   05131 Shigellosis
    64127 (NOD2)
   05152 Tuberculosis
    64127 (NOD2)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   64127 (NOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT CARD LRR_6 AAA_16 LRR_4 LRR_8 AAA_22 AAA_29 AAA_30 AAA_25 NB-ARC ABC_tran AAA_33
Motif
Other DBs
NCBI-GeneID: 64127
NCBI-ProteinID: NP_071445
OMIM: 605956
HGNC: 5331
Ensembl: ENSG00000167207
Vega: OTTHUMG00000133171
Pharos: Q9HC29(Tclin)
UniProt: Q9HC29
LinkDB All DBs
Position
16q12.1
AA seq 1040 aa AA seqDB search
MGEEGGSASHDEEERASVLLGHSPGCEMCSQEAFQAQRSQLVELLVSGSLEGFESVLDWL
LSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLH
GCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQR
ARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEAATCKKYMAKLRTTVSAQSRFLSTY
DGAETLCLEDIYTENVLEVWADVGMAGPPQKSPATLGLEELFSTPGHLNDDADTVLVVGE
AGSGKSTLLQRLHLLWAAGQDFQEFLFVFPFSCRQLQCMAKPLSVRTLLFEHCCWPDVGQ
EDIFQLLLDHPDRVLLTFDGFDEFKFRFTDRERHCSPTDPTSVQTLLFNLLQGNLLKNAR
KVVTSRPAAVSAFLRKYIRTEFNLKGFSEQGIELYLRKRHHEPGVADRLIRLLQETSALH
GLCHLPVFSWMVSKCHQELLLQEGGSPKTTTDMYLLILQHFLLHATPPDSASQGLGPSLL
RGRLPTLLHLGRLALWGLGMCCYVFSAQQLQAAQVSPDDISLGFLVRAKGVVPGSTAPLE
FLHITFQCFFAAFYLALSADVPPALLRHLFNCGRPGNSPMARLLPTMCIQASEGKDSSVA
ALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKALLRRQACARWCLARSLRKHFH
SIPPAAPGEAKSVHAMPGFIWLIRSLYEMQEERLARKAARGLNVGHLKLTFCSVGPTECA
ALAFVLQHLRRPVALQLDYNSVGDIGVEQLLPCLGVCKALYLRDNNISDRGICKLIECAL
HCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGLRGNTS
LQFLGFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEEL
CLEENHLQDEGVCSLAEGLKKNSSLKILKLSNNCITYLGAEALLQALERNDTILEVWLRG
NTFSLEEVDKLGCRDTRLLL
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atgggggaagagggtggttcagcctctcacgatgaggaggaaagagcaagtgtcctcctc
ggacattctccgggttgtgaaatgtgctcgcaggaggcttttcaggcacagaggagccag
ctggtcgagctgctggtctcagggtccctggaaggcttcgagagtgtcctggactggctg
ctgtcctgggaggtcctctcctgggaggactacgagggcttccacctcctgggccagcct
ctctcccacttggccaggcgccttctggacaccgtctggaataagggtacttgggcctgt
cagaagctcatcgcggctgcccaagaagcccaggccgacagccagtcccccaagctgcat
ggctgctgggacccccactcgctccacccagcccgagacctgcagagtcaccggccagcc
attgtcaggaggctccacagccatgtggagaacatgctggacctggcatgggagcggggt
ttcgtcagccagtatgaatgtgatgaaatcaggttgccgatcttcacaccgtcccagagg
gcaagaaggctgcttgatcttgccacggtgaaagcgaatggattggctgccttccttcta
caacatgttcaggaattaccagtcccattggccctgcctttggaagctgccacatgcaag
aagtatatggccaagctgaggaccacggtgtctgctcagtctcgcttcctcagtacctat
gatggagcagagacgctctgcctggaggacatatacacagagaatgtcctggaggtctgg
gcagatgtgggcatggctggacccccgcagaagagcccagccaccctgggcctggaggag
ctcttcagcacccctggccacctcaatgacgatgcggacactgtgctggtggtgggtgag
gcgggcagtggcaagagcacgctcctgcagcggctgcacttgctgtgggctgcagggcaa
gacttccaggaatttctctttgtcttcccattcagctgccggcagctgcagtgcatggcc
aaaccactctctgtgcggactctactctttgagcactgctgttggcctgatgttggtcaa
gaagacatcttccagttactccttgaccaccctgaccgtgtcctgttaacctttgatggc
tttgacgagttcaagttcaggttcacggatcgtgaacgccactgctccccgaccgacccc
acctctgtccagaccctgctcttcaaccttctgcagggcaacctgctgaagaatgcccgc
aaggtggtgaccagccgtccggccgctgtgtcggcgttcctcaggaagtacatccgcacc
gagttcaacctcaagggcttctctgaacagggcatcgagctgtacctgaggaagcgccat
catgagcccggggtggcggaccgcctcatccgcctgctccaagagacctcagccctgcac
ggtttgtgccacctgcctgtcttctcatggatggtgtccaaatgccaccaggaactgttg
ctgcaggagggggggtccccaaagaccactacagatatgtacctgctgattctgcagcat
tttctgctgcatgccacccccccagactcagcttcccaaggtctgggacccagtcttctt
cggggccgcctccccaccctcctgcacctgggcagactggctctgtggggcctgggcatg
tgctgctacgtgttctcagcccagcagctccaggcagcacaggtcagccctgatgacatt
tctcttggcttcctggtgcgtgccaaaggtgtcgtgccagggagtacggcgcccctggaa
ttccttcacatcactttccagtgcttctttgccgcgttctacctggcactcagtgctgat
gtgccaccagctttgctcagacacctcttcaattgtggcaggccaggcaactcaccaatg
gccaggctcctgcccacgatgtgcatccaggcctcggagggaaaggacagcagcgtggca
gctttgctgcagaaggccgagccgcacaaccttcagatcacagcagccttcctggcaggg
ctgttgtcccgggagcactggggcctgctggctgagtgccagacatctgagaaggccctg
ctccggcgccaggcctgtgcccgctggtgtctggcccgcagcctccgcaagcacttccac
tccatcccgccagctgcaccgggtgaggccaagagcgtgcatgccatgcccgggttcatc
tggctcatccggagcctgtacgagatgcaggaggagcggctggctcggaaggctgcacgt
ggcctgaatgttgggcacctcaagttgacattttgcagtgtgggccccactgagtgtgct
gccctggcctttgtgctgcagcacctccggcggcccgtggccctgcagctggactacaac
tctgtgggtgacattggcgtggagcagctgctgccttgccttggtgtctgcaaggctctg
tatttgcgcgataacaatatctcagaccgaggcatctgcaagctcattgaatgtgctctt
cactgcgagcaattgcagaagttagctctattcaacaacaaattgactgacggctgtgca
cactccatggctaagctccttgcatgcaggcagaacttcttggcattgaggctggggaat
aactacatcactgccgcgggagcccaagtgctggccgaggggctccgaggcaacacctcc
ttgcagttcctgggattctggggcaacagagtgggtgacgagggggcccaggccctggct
gaagccttgggtgatcaccagagcttgaggtggctcagcctggtggggaacaacattggc
agtgtgggtgcccaagccttggcactgatgctggcaaagaacgtcatgctagaagaactc
tgcctggaggagaaccatctccaggatgaaggtgtatgttctctcgcagaaggactgaag
aaaaattcaagtttgaaaatcctgaagttgtccaataactgcatcacctacctaggggca
gaagccctcctgcaggcccttgaaaggaatgacaccatcctggaagtctggctccgaggg
aacactttctctctagaggaggttgacaagctcggctgcagggacaccagactcttgctt
tga

DBGET integrated database retrieval system