KEGG   Homo sapiens (human): 6422Help
Entry
6422              CDS       T01001                                 

Gene name
SFRP1, FRP, FRP-1, FRP1, FrzA, SARP2
Definition
(RefSeq) secreted frizzled related protein 1
  KO
K02166  secreted frizzled-related protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6422 (SFRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fz NTR DUF555
Motif
Other DBs
NCBI-GeneID: 6422
NCBI-ProteinID: NP_003003
OMIM: 604156
HGNC: 10776
Ensembl: ENSG00000104332
Vega: OTTHUMG00000164074
Pharos: Q8N474(Tchem)
UniProt: Q8N474
LinkDB All DBs
Position
8p11.21
AA seq 314 aa AA seqDB search
MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVD
IPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPV
CLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKP
QGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKK
KDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKK
MKNHECPTFQSVFK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcgggcgcagcgaggggggccgccgcggggcagccctgggcgtgctgctggcg
ctgggcgcggcgcttctggccgtgggctcggccagcgagtacgactacgtgagcttccag
tcggacatcggcccgtaccagagcgggcgcttctacaccaagccacctcagtgcgtggac
atccccgcggacctgcggctgtgccacaacgtgggctacaagaagatggtgctgcccaac
ctgctggagcacgagaccatggcggaggtgaagcagcaggccagcagctgggtgcccctg
ctcaacaagaactgccacgccggcacccaggtcttcctctgctcgctcttcgcgcccgtc
tgcctggaccggcccatctacccgtgtcgctggctctgcgaggccgtgcgcgactcgtgc
gagccggtcatgcagttcttcggcttctactggcccgagatgcttaagtgtgacaagttc
cccgagggggacgtctgcatcgccatgacgccgcccaatgccaccgaagcctccaagccc
caaggcacaacggtgtgtcctccctgtgacaacgagttgaaatctgaggccatcattgaa
catctctgtgccagcgagtttgcactgaggatgaaaataaaagaagtgaaaaaagaaaat
ggcgacaagaagattgtccccaagaagaagaagcccctgaagttggggcccatcaagaag
aaggacctgaagaagcttgtgctgtacctgaagaatggggctgactgtccctgccaccag
ctggacaacctcagccaccacttcctcatcatgggccgcaaggtgaagagccagtacttg
ctgacggccatccacaagtgggacaagaaaaacaaggagttcaaaaacttcatgaagaaa
atgaaaaaccatgagtgccccacctttcagtccgtgtttaagtga

KEGG   Homo sapiens (human): 6423Help
Entry
6423              CDS       T01001                                 

Gene name
SFRP2, FRP-2, SARP1, SDF-5
Definition
(RefSeq) secreted frizzled related protein 2
  KO
K02176  secreted frizzled-related protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6423 (SFRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fz NTR
Motif
Other DBs
NCBI-GeneID: 6423
NCBI-ProteinID: NP_003004
OMIM: 604157
HGNC: 10777
Ensembl: ENSG00000145423
Vega: OTTHUMG00000161559
Pharos: Q96HF1(Tbio)
UniProt: Q96HF1 B3KSM5 A0A140VJU3
LinkDB All DBs
Position
4q31.3
AA seq 295 aa AA seqDB search
MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRL
PNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQ
VKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKND
DDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLK
DSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagggccctggctcgctgctgctgctcttcctcgcctcgcactgctgcctgggc
tcggcgcgcgggctcttcctctttggccagcccgacttctcctacaagcgcagcaattgc
aagcccatccctgccaacctgcagctgtgccacggcatcgaataccagaacatgcggctg
cccaacctgctgggccacgagaccatgaaggaggtgctggagcaggccggcgcttggatc
ccgctggtcatgaagcagtgccacccggacaccaagaagttcctgtgctcgctcttcgcc
cccgtctgcctcgatgacctagacgagaccatccagccatgccactcgctctgcgtgcag
gtgaaggaccgctgcgccccggtcatgtccgccttcggcttcccctggcccgacatgctt
gagtgcgaccgtttcccccaggacaacgacctttgcatccccctcgctagcagcgaccac
ctcctgccagccaccgaggaagctccaaaggtatgtgaagcctgcaaaaataaaaatgat
gatgacaacgacataatggaaacgctttgtaaaaatgattttgcactgaaaataaaagtg
aaggagataacctacatcaaccgagataccaaaatcatcctggagaccaagagcaagacc
atttacaagctgaacggtgtgtccgaaagggacctgaagaaatcggtgctgtggctcaaa
gacagcttgcagtgcacctgtgaggagatgaacgacatcaacgcgccctatctggtcatg
ggacagaaacagggtggggagctggtgatcacctcggtgaagcggtggcagaaggggcag
agagagttcaagcgcatctcccgcagcatccgcaagctgcagtgctag

KEGG   Homo sapiens (human): 6424Help
Entry
6424              CDS       T01001                                 

Gene name
SFRP4, FRP-4, FRPHE, FRZB-2, PYL, sFRP-4
Definition
(RefSeq) secreted frizzled related protein 4
  KO
K02185  secreted frizzled-related protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6424 (SFRP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fz NTR
Motif
Other DBs
NCBI-GeneID: 6424
NCBI-ProteinID: NP_003005
OMIM: 606570
HGNC: 10778
Ensembl: ENSG00000106483
Vega: OTTHUMG00000023026
Pharos: Q6FHJ7(Tbio)
UniProt: Q6FHJ7
LinkDB All DBs
Position
7p14.1
AA seq 346 aa AA seqDB search
MFLSILVALCLWLHLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQ
YEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWP
ESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKC
KKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITN
SSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQD
KKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgttcctctccatcctagtggcgctgtgcctgtggctgcacctggcgctgggcgtgcgc
ggcgcgccctgcgaggcggtgcgcatccctatgtgccggcacatgccctggaacatcacg
cggatgcccaaccacctgcaccacagcacgcaggagaacgccatcctggccatcgagcag
tacgaggagctggtggacgtgaactgcagcgccgtgctgcgcttcttcctctgtgccatg
tacgcgcccatttgcaccctggagttcctgcacgaccctatcaagccgtgcaagtcggtg
tgccaacgcgcgcgcgacgactgcgagcccctcatgaagatgtacaaccacagctggccc
gaaagcctggcctgcgacgagctgcctgtctatgaccgtggcgtgtgcatctcgcctgaa
gccatcgtcacggacctcccggaggatgttaagtggatagacatcacaccagacatgatg
gtacaggaaaggcctcttgatgttgactgtaaacgcctaagccccgatcggtgcaagtgt
aaaaaggtgaagccaactttggcaacgtatctcagcaaaaactacagctatgttattcat
gccaaaataaaagctgtgcagaggagtggctgcaatgaggtcacaacggtggtggatgta
aaagagatcttcaagtcctcatcacccatccctcgaactcaagtcccgctcattacaaat
tcttcttgccagtgtccacacatcctgccccatcaagatgttctcatcatgtgttacgag
tggcgctcaaggatgatgcttcttgaaaattgcttagttgaaaaatggagagatcagctt
agtaaaagatccatacagtgggaagagaggctgcaggaacagcggagaacagttcaggac
aagaagaaaacagccgggcgcaccagtcgtagtaatccccccaaaccaaagggaaagcct
cctgctcccaaaccagccagtcccaagaagaacattaaaactaggagtgcccagaagaga
acaaacccgaaaagagtgtga

KEGG   Homo sapiens (human): 6425Help
Entry
6425              CDS       T01001                                 

Gene name
SFRP5, SARP3
Definition
(RefSeq) secreted frizzled related protein 5
  KO
K02222  secreted frizzled-related protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6425 (SFRP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fz NTR
Motif
Other DBs
NCBI-GeneID: 6425
NCBI-ProteinID: NP_003006
OMIM: 604158
HGNC: 10779
Ensembl: ENSG00000120057
Vega: OTTHUMG00000018866
Pharos: Q5T4F7(Tbio)
UniProt: Q5T4F7
LinkDB All DBs
Position
10q24.2
AA seq 317 aa AA seqDB search
MRAAAAGGGVRTAALALLLGALHWAPARCEEYDYYGWQAEPLHGRSYSKPPQCLDIPADL
PLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRP
IYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKI
CAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDT
KRLVLHMKNGAGCPCPQLDSLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFS
YPCSLYYPFFYGAAEPH
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcggcggcggcgggggggggcgtgcggacggccgcgctggcgctgctgctgggg
gcgctgcactgggcgccggcgcgctgcgaggagtacgactactatggctggcaggccgag
ccgctgcacggccgctcctactccaagccgccgcagtgccttgacatccctgccgacctg
ccgctctgccacacggtgggctacaagcgcatgcggctgcccaacctgctggagcacgag
agcctggccgaagtgaagcagcaggcgagcagctggctgccgctgctggccaagcgctgc
cactcggatacgcaggtcttcctgtgctcgctctttgcgcccgtctgtctcgaccggccc
atctacccgtgccgctcgctgtgcgaggccgtgcgcgccggctgcgcgccgctcatggag
gcctacggcttcccctggcctgagatgctgcactgccacaagttccccctggacaacgac
ctctgcatcgccgtgcagttcgggcacctgcccgccaccgcgcctccagtgaccaagatc
tgcgcccagtgtgagatggagcacagtgctgacggcctcatggagcagatgtgctccagt
gactttgtggtcaaaatgcgcatcaaggagatcaagatagagaatggggaccggaagctg
attggagcccagaaaaagaagaagctgctcaagccgggccccctgaagcgcaaggacacc
aagcggctggtgctgcacatgaagaatggcgcgggctgcccctgcccacagctggacagc
ctggcgggcagcttcctggtcatgggccgcaaagtggatggacagctgctgctcatggcc
gtctaccgctgggacaagaagaataaggagatgaagtttgcagtcaaattcatgttctcc
tacccctgctccctctactaccctttcttctacggggcggcagagccccactga

DBGET integrated database retrieval system