KEGG   Homo sapiens (human): 64220
Entry
64220             CDS       T01001                                 

Gene name
STRA6, MCOPCB8, MCOPS9, PP14296
Definition
(RefSeq) signaling receptor and transporter of retinol STRA6
  KO
K23088  vitamin A receptor/transporter (stra6) family protein
Organism
hsa  Homo sapiens (human)
Disease
H01027  Microphthalmia
H02170  Microphthalmia, syndromic
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    64220 (STRA6)
Transporters [BR:hsa02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   64220 (STRA6)
SSDB
Motif
Pfam: RBP_receptor DUF443
Other DBs
NCBI-GeneID: 64220
NCBI-ProteinID: NP_001136089
OMIM: 610745
HGNC: 30650
Ensembl: ENSG00000137868
Vega: OTTHUMG00000138998
Pharos: Q9BX79(Tbio)
UniProt: Q9BX79 B3KPB8
LinkDB
Position
15q24.1
AA seq 667 aa
MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPGLYHACLASLS
ILVLLLLAMLVRRRQLWPDCVRGRPGLPSPVDFLAGDRPRAVPAAVFMVLLSSLCLLLPD
EDALPFLTLASAPSQDGKTEAPRGAWKILGLFYYAALYYPLAACATAGHTAAHLLGSTLS
WAHLGVQVWQRAECPQVPKIYKYYSLLASLPLLLGLGFLSLWYPVQLVRSFSRRTGAGSK
GLQSSYSEEYLRNLLCRKKLGSSYHTSKHGFLSWARVCLRHCIYTPQPGFHLPLKLVLSA
TLTGTAIYQVALLLLVGVVPTIQKVRAGVTTDVSYLLAGFGIVLSEDKQEVVELVKHHLW
ALEVCYISALVLSCLLTFLVLMRSLVTHRTNLRALHRGAALDLSPLHRSPHPSRQAIFCW
MSFSAYQTAFICLGLLVQQIIFFLGTTALAFLVLMPVLHGRNLLLFRSLESSWPFWLTLA
LAVILQNMAAHWVFLETHDGHPQLTNRRVLYAATFLLFPLNVLVGAMVATWRVLLSALYN
AIHLGQMDLSLLPPRAATLDPGYYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMA
APQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRGRARWGLAYTLLHNPTLQVFRKTALL
GANGAQP
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgtcgtcccagccagcagggaaccagacctcccccggggccacagaggactactcctat
ggcagctggtacatcgatgagccccaggggggcgaggagctccagccagagggggaagtg
ccctcctgccacaccagcataccacccggcctgtaccacgcctgcctggcctcgctgtca
atccttgtgctgctgctcctggccatgctggtgaggcgccgccagctctggcctgactgt
gtgcgtggcaggcccggcctgcccagccctgtggatttcttggctggggacaggccccgg
gcagtgcctgctgctgttttcatggtcctcctgagctccctgtgtttgctgctccccgac
gaggacgcattgcccttcctgactctcgcctcagcacccagccaagatgggaaaactgag
gctccaagaggggcctggaagatactgggactgttctattatgctgccctctactaccct
ctggctgcctgtgccacggctggccacacagctgcacacctgctcggcagcacgctgtcc
tgggcccaccttggggtccaggtctggcagagggcagagtgtccccaggtgcccaagatc
tacaagtactactccctgctggcctccctgcctctcctgctgggcctcggattcctgagc
ctttggtaccctgtgcagctggtgagaagcttcagccgtaggacaggagcaggctccaag
gggctgcagagcagctactctgaggaatatctgaggaacctcctttgcaggaagaagctg
ggaagcagctaccacacctccaagcatggcttcctgtcctgggcccgcgtctgcttgaga
cactgcatctacactccacagccaggattccatctcccgctgaagctggtgctttcagct
acactgacagggacggccatttaccaggtggccctgctgctgctggtgggcgtggtaccc
actatccagaaggtgagggcaggggtcaccacggatgtctcctacctgctggccggcttt
ggaatcgtgctctccgaggacaagcaggaggtggtggagctggtgaagcaccatctgtgg
gctctggaagtgtgctacatctcagccttggtcttgtcctgcttactcaccttcctggtc
ctgatgcgctcactggtgacacacaggaccaaccttcgagctctgcaccgaggagctgcc
ctggacttgagtcccttgcatcggagtccccatccctcccgccaagccatattctgttgg
atgagcttcagtgcctaccagacagcctttatctgccttgggctcctggtgcagcagatc
atcttcttcctgggaaccacggccctggccttcctggtgctcatgcctgtgctccatggc
aggaacctcctgctcttccgttccctggagtcctcgtggcccttctggctgactttggcc
ctggctgtgatcctgcagaacatggcagcccattgggtcttcctggagactcatgatgga
cacccacagctgaccaaccggcgagtgctctatgcagccacctttcttctcttccccctc
aatgtgctggtgggtgccatggtggccacctggcgagtgctcctctctgccctctacaac
gccatccaccttggccagatggacctcagcctgctgccaccgagagccgccactctcgac
cccggctactacacgtaccgaaacttcttgaagattgaagtcagccagtcgcatccagcc
atgacagccttctgctccctgctcctgcaagcgcagagcctcctacccaggaccatggca
gccccccaggacagcctcagaccaggggaggaagacgaagggatgcagctgctacagaca
aaggactccatggccaagggagctaggcccggggccagccgcggcagggctcgctggggt
ctggcctacacgctgctgcacaacccaaccctgcaggtcttccgcaagacggccctgttg
ggtgccaatggtgcccagccctga

DBGET integrated database retrieval system